Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NAY6

Protein Details
Accession A0A1B7NAY6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
176-205DVFAEHLPTKKKKKLWRRKDQPKFDYPWKEBasic
NLS Segment(s)
PositionSequence
185-195KKKKKLWRRKD
Subcellular Location(s) cyto_nucl 11.333, cyto 11, nucl 10.5, cyto_mito 6.333, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MNGSIPPEIVPSSTSLSSPFPGDFTTAGDIGSTDWSTSYHGLSTQAFSKDIAEILLAPVDEMDIEMKPDGLIYLPEIKYRRVLNKAFGPGGWGLAPRSETNVGPKVVSREYALVCQGRLVAVARGEQEYFDPSNIPTATEGCKSNALMRCCKDLGIASELWDPRFIREFKAKHCVDVFAEHLPTKKKKKLWRRKDQPKFDYPWKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.19
5 0.2
6 0.18
7 0.15
8 0.15
9 0.16
10 0.15
11 0.15
12 0.16
13 0.14
14 0.14
15 0.13
16 0.12
17 0.11
18 0.13
19 0.11
20 0.08
21 0.08
22 0.09
23 0.11
24 0.12
25 0.12
26 0.1
27 0.11
28 0.13
29 0.14
30 0.15
31 0.17
32 0.18
33 0.17
34 0.17
35 0.17
36 0.15
37 0.15
38 0.13
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.05
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.05
59 0.06
60 0.12
61 0.12
62 0.17
63 0.18
64 0.19
65 0.22
66 0.26
67 0.3
68 0.3
69 0.31
70 0.33
71 0.37
72 0.4
73 0.36
74 0.32
75 0.29
76 0.22
77 0.21
78 0.16
79 0.11
80 0.08
81 0.08
82 0.1
83 0.07
84 0.1
85 0.11
86 0.11
87 0.14
88 0.18
89 0.17
90 0.16
91 0.17
92 0.17
93 0.16
94 0.17
95 0.13
96 0.12
97 0.13
98 0.14
99 0.16
100 0.13
101 0.13
102 0.12
103 0.11
104 0.09
105 0.09
106 0.08
107 0.07
108 0.07
109 0.08
110 0.09
111 0.1
112 0.1
113 0.09
114 0.09
115 0.11
116 0.11
117 0.1
118 0.1
119 0.09
120 0.14
121 0.14
122 0.14
123 0.11
124 0.12
125 0.14
126 0.16
127 0.17
128 0.15
129 0.16
130 0.17
131 0.22
132 0.27
133 0.28
134 0.32
135 0.33
136 0.36
137 0.35
138 0.34
139 0.29
140 0.25
141 0.25
142 0.22
143 0.2
144 0.17
145 0.22
146 0.23
147 0.22
148 0.23
149 0.2
150 0.2
151 0.26
152 0.25
153 0.25
154 0.34
155 0.37
156 0.4
157 0.5
158 0.47
159 0.45
160 0.46
161 0.44
162 0.37
163 0.36
164 0.33
165 0.27
166 0.29
167 0.26
168 0.29
169 0.33
170 0.4
171 0.45
172 0.5
173 0.55
174 0.62
175 0.73
176 0.8
177 0.84
178 0.87
179 0.89
180 0.93
181 0.96
182 0.96
183 0.94
184 0.92
185 0.89