Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MGS3

Protein Details
Accession A0A1B7MGS3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-46GNKHNSSKANHKAKLRRRRPKPHLPPQRRPLHLHBasic
61-84LPLSYSSKAKPRCRKPHLLSHLPRHydrophilic
NLS Segment(s)
PositionSequence
16-42HNSSKANHKAKLRRRRPKPHLPPQRRP
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MLLVDRNDLATRGNKHNSSKANHKAKLRRRRPKPHLPPQRRPLHLHRLPQWVQQPRSHNPLPLSYSSKAKPRCRKPHLLSHLPRLPHIFCVLCIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.52
4 0.56
5 0.56
6 0.6
7 0.63
8 0.65
9 0.66
10 0.7
11 0.72
12 0.76
13 0.81
14 0.82
15 0.82
16 0.83
17 0.89
18 0.9
19 0.91
20 0.92
21 0.92
22 0.92
23 0.91
24 0.91
25 0.89
26 0.89
27 0.81
28 0.76
29 0.72
30 0.71
31 0.67
32 0.63
33 0.58
34 0.57
35 0.55
36 0.54
37 0.54
38 0.51
39 0.48
40 0.47
41 0.48
42 0.44
43 0.5
44 0.46
45 0.42
46 0.36
47 0.37
48 0.35
49 0.33
50 0.35
51 0.29
52 0.33
53 0.32
54 0.39
55 0.44
56 0.5
57 0.57
58 0.62
59 0.72
60 0.75
61 0.84
62 0.82
63 0.85
64 0.84
65 0.85
66 0.8
67 0.79
68 0.76
69 0.66
70 0.62
71 0.56
72 0.48
73 0.4
74 0.38
75 0.29