Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N5X5

Protein Details
Accession A0A1B7N5X5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MMHELKKEKKENKSTHLRRRPQTPSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MMHELKKEKKENKSTHLRRRPQTPSYQEGEEDLSLRGVSLAYIDNASGTYAATTVTNMAHEKDTPTPATDAVPKKIASFLETFRVVHELWRVLADSRLKYRPRYGLVLLGTSRREIEELSAVTSVTVDERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.88
4 0.87
5 0.83
6 0.84
7 0.83
8 0.79
9 0.79
10 0.74
11 0.7
12 0.65
13 0.6
14 0.51
15 0.44
16 0.39
17 0.29
18 0.23
19 0.17
20 0.13
21 0.11
22 0.1
23 0.09
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.1
49 0.11
50 0.13
51 0.12
52 0.13
53 0.13
54 0.12
55 0.13
56 0.18
57 0.18
58 0.18
59 0.2
60 0.19
61 0.19
62 0.21
63 0.2
64 0.16
65 0.16
66 0.15
67 0.17
68 0.18
69 0.18
70 0.16
71 0.19
72 0.16
73 0.16
74 0.17
75 0.13
76 0.12
77 0.13
78 0.13
79 0.12
80 0.16
81 0.18
82 0.19
83 0.24
84 0.31
85 0.33
86 0.36
87 0.42
88 0.45
89 0.45
90 0.47
91 0.43
92 0.42
93 0.4
94 0.41
95 0.36
96 0.32
97 0.29
98 0.25
99 0.23
100 0.18
101 0.17
102 0.14
103 0.15
104 0.17
105 0.17
106 0.18
107 0.18
108 0.17
109 0.16
110 0.16
111 0.13