Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZG31

Protein Details
Accession C7ZG31    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
288-310ASNERREKKYALQKQLRKANERRHydrophilic
NLS Segment(s)
PositionSequence
303-309LRKANER
Subcellular Location(s) mito 17, nucl 9
Family & Domain DBs
KEGG nhe:NECHADRAFT_52057  -  
Amino Acid Sequences MNVFRSFFNILKAKNPPQQMARMAQTVRASINPSHDFLQRCNPFKDLPDDPDTVKTFREVSYIKAKLQYYLVPTSLPGDDYALCSKLLRSLETRHDLTWLVLDETGTRDTIQAIGRRGTPREPIPEEPFDLSQRAKTLAAHWTALAKLPEHPRKWEAAFSTQHQPPLITEEFKLELDPEQTADLEKEYTEWRTRRDEKAAYLKYNPPHPTGYVQATRDQVPVDETWELLPWVIFEGAASPNDGSRRWLPIYTSLLSQNIPFGWRAPDAPPPKQKTQEEKDQWEREYRASNERREKKYALQKQLRKANERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.54
4 0.54
5 0.59
6 0.58
7 0.55
8 0.51
9 0.5
10 0.46
11 0.45
12 0.41
13 0.36
14 0.32
15 0.28
16 0.28
17 0.24
18 0.31
19 0.29
20 0.3
21 0.31
22 0.34
23 0.34
24 0.33
25 0.42
26 0.41
27 0.44
28 0.44
29 0.44
30 0.41
31 0.42
32 0.46
33 0.4
34 0.38
35 0.39
36 0.38
37 0.37
38 0.41
39 0.4
40 0.35
41 0.31
42 0.26
43 0.23
44 0.21
45 0.25
46 0.2
47 0.22
48 0.31
49 0.33
50 0.33
51 0.37
52 0.37
53 0.33
54 0.35
55 0.33
56 0.28
57 0.28
58 0.27
59 0.21
60 0.21
61 0.21
62 0.19
63 0.16
64 0.12
65 0.1
66 0.1
67 0.13
68 0.15
69 0.13
70 0.13
71 0.13
72 0.12
73 0.16
74 0.16
75 0.16
76 0.17
77 0.21
78 0.29
79 0.34
80 0.36
81 0.31
82 0.31
83 0.3
84 0.27
85 0.24
86 0.17
87 0.12
88 0.11
89 0.11
90 0.1
91 0.11
92 0.12
93 0.1
94 0.09
95 0.08
96 0.08
97 0.11
98 0.14
99 0.15
100 0.17
101 0.18
102 0.22
103 0.24
104 0.25
105 0.25
106 0.26
107 0.26
108 0.3
109 0.33
110 0.34
111 0.37
112 0.37
113 0.36
114 0.34
115 0.32
116 0.26
117 0.24
118 0.19
119 0.15
120 0.14
121 0.14
122 0.13
123 0.12
124 0.13
125 0.16
126 0.17
127 0.16
128 0.15
129 0.15
130 0.14
131 0.16
132 0.14
133 0.1
134 0.13
135 0.21
136 0.28
137 0.29
138 0.32
139 0.31
140 0.34
141 0.34
142 0.33
143 0.26
144 0.25
145 0.26
146 0.27
147 0.32
148 0.3
149 0.3
150 0.27
151 0.25
152 0.19
153 0.23
154 0.21
155 0.15
156 0.14
157 0.15
158 0.16
159 0.16
160 0.15
161 0.1
162 0.1
163 0.1
164 0.1
165 0.08
166 0.07
167 0.07
168 0.08
169 0.07
170 0.07
171 0.06
172 0.06
173 0.07
174 0.08
175 0.11
176 0.17
177 0.19
178 0.22
179 0.3
180 0.36
181 0.39
182 0.44
183 0.44
184 0.44
185 0.53
186 0.54
187 0.49
188 0.48
189 0.48
190 0.45
191 0.5
192 0.46
193 0.38
194 0.35
195 0.34
196 0.32
197 0.31
198 0.34
199 0.31
200 0.3
201 0.31
202 0.31
203 0.31
204 0.29
205 0.25
206 0.2
207 0.17
208 0.16
209 0.15
210 0.13
211 0.12
212 0.11
213 0.11
214 0.11
215 0.09
216 0.08
217 0.06
218 0.07
219 0.06
220 0.06
221 0.05
222 0.07
223 0.08
224 0.09
225 0.1
226 0.08
227 0.1
228 0.12
229 0.13
230 0.15
231 0.16
232 0.22
233 0.23
234 0.24
235 0.24
236 0.29
237 0.34
238 0.31
239 0.31
240 0.28
241 0.27
242 0.26
243 0.25
244 0.2
245 0.15
246 0.15
247 0.13
248 0.13
249 0.15
250 0.15
251 0.17
252 0.18
253 0.27
254 0.32
255 0.4
256 0.48
257 0.52
258 0.58
259 0.65
260 0.71
261 0.72
262 0.73
263 0.75
264 0.74
265 0.77
266 0.8
267 0.77
268 0.72
269 0.7
270 0.65
271 0.58
272 0.58
273 0.52
274 0.53
275 0.54
276 0.61
277 0.64
278 0.71
279 0.73
280 0.71
281 0.72
282 0.71
283 0.75
284 0.75
285 0.75
286 0.76
287 0.78
288 0.81
289 0.86
290 0.84