Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8EH12

Protein Details
Accession A0A1B8EH12    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-60ARLFRFCRSKCHKNFKMKRNPRKLKWTKAFRKSAGHydrophilic
NLS Segment(s)
PositionSequence
40-58FKMKRNPRKLKWTKAFRKS
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIETCYFCSQPCYPSKGITFVRNDARLFRFCRSKCHKNFKMKRNPRKLKWTKAFRKSAGKEMVVDSTLTFAARRNVPVRYNRDLVATTLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.39
4 0.41
5 0.43
6 0.43
7 0.42
8 0.41
9 0.46
10 0.45
11 0.43
12 0.4
13 0.4
14 0.38
15 0.38
16 0.37
17 0.39
18 0.36
19 0.46
20 0.5
21 0.57
22 0.62
23 0.7
24 0.73
25 0.75
26 0.84
27 0.85
28 0.87
29 0.87
30 0.89
31 0.89
32 0.9
33 0.85
34 0.87
35 0.85
36 0.84
37 0.83
38 0.83
39 0.82
40 0.82
41 0.83
42 0.76
43 0.78
44 0.71
45 0.69
46 0.64
47 0.55
48 0.47
49 0.41
50 0.38
51 0.28
52 0.25
53 0.16
54 0.12
55 0.11
56 0.1
57 0.09
58 0.09
59 0.13
60 0.15
61 0.2
62 0.22
63 0.27
64 0.33
65 0.41
66 0.47
67 0.48
68 0.49
69 0.45
70 0.46
71 0.42
72 0.39