Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8F4G0

Protein Details
Accession A0A1B8F4G0   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-43ASNIGKPPSKQKGRRNIMLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 20, nucl 3, cyto 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045038  AIG2-like  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
CDD cd06661  GGCT_like  
Amino Acid Sequences MDGFGASSSAPKAVEGEQERPEHASNIGKPPSKQKGRRNIMLEKFRADVEPSRPPYTYTPMPFFLYGSLTDPLRLQEILQLPALPVLKPASVQCYRIMLWGQYPALVHGPINNHVDGMAFVVETEEQEKMLKYYETDAYHIEGVRISVDGKLVSGRTFVWASDPAELVEGTWSLEEWKKDIEEEMASHFRPLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.28
4 0.33
5 0.34
6 0.35
7 0.36
8 0.36
9 0.29
10 0.27
11 0.29
12 0.27
13 0.34
14 0.39
15 0.4
16 0.4
17 0.48
18 0.56
19 0.6
20 0.65
21 0.66
22 0.71
23 0.76
24 0.82
25 0.79
26 0.78
27 0.77
28 0.77
29 0.69
30 0.61
31 0.54
32 0.46
33 0.4
34 0.34
35 0.29
36 0.26
37 0.33
38 0.35
39 0.36
40 0.36
41 0.37
42 0.38
43 0.39
44 0.4
45 0.35
46 0.34
47 0.34
48 0.35
49 0.33
50 0.3
51 0.24
52 0.19
53 0.15
54 0.14
55 0.13
56 0.11
57 0.12
58 0.12
59 0.11
60 0.11
61 0.11
62 0.08
63 0.12
64 0.14
65 0.15
66 0.14
67 0.14
68 0.12
69 0.15
70 0.15
71 0.1
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.13
78 0.14
79 0.16
80 0.15
81 0.17
82 0.17
83 0.18
84 0.18
85 0.12
86 0.11
87 0.12
88 0.11
89 0.1
90 0.09
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.1
97 0.13
98 0.15
99 0.14
100 0.12
101 0.12
102 0.12
103 0.1
104 0.1
105 0.06
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.06
112 0.05
113 0.05
114 0.06
115 0.06
116 0.07
117 0.08
118 0.08
119 0.08
120 0.11
121 0.16
122 0.17
123 0.18
124 0.19
125 0.19
126 0.21
127 0.2
128 0.17
129 0.12
130 0.11
131 0.1
132 0.09
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.12
144 0.12
145 0.12
146 0.14
147 0.16
148 0.17
149 0.18
150 0.19
151 0.15
152 0.16
153 0.16
154 0.13
155 0.1
156 0.09
157 0.08
158 0.07
159 0.07
160 0.09
161 0.13
162 0.14
163 0.15
164 0.17
165 0.18
166 0.19
167 0.2
168 0.2
169 0.19
170 0.19
171 0.24
172 0.26
173 0.26
174 0.26