Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8F1Z3

Protein Details
Accession A0A1B8F1Z3   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28SSGIQEGRVKKKKQKAPSRAARMSAKHydrophilic
NLS Segment(s)
PositionSequence
10-29RVKKKKQKAPSRAARMSAKS
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
Amino Acid Sequences MMSSGIQEGRVKKKKQKAPSRAARMSAKSYGSIIRKPRPFSAVEPTNPRIQSSRCLEGGGEGRRSLNKYSKLCKKFNEQGSILAEEEKVEEDEAEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.82
4 0.82
5 0.84
6 0.88
7 0.89
8 0.83
9 0.8
10 0.76
11 0.68
12 0.62
13 0.55
14 0.46
15 0.36
16 0.33
17 0.32
18 0.29
19 0.31
20 0.33
21 0.37
22 0.41
23 0.44
24 0.45
25 0.42
26 0.41
27 0.39
28 0.41
29 0.39
30 0.37
31 0.4
32 0.39
33 0.41
34 0.39
35 0.36
36 0.29
37 0.24
38 0.28
39 0.26
40 0.28
41 0.23
42 0.23
43 0.22
44 0.23
45 0.28
46 0.24
47 0.21
48 0.18
49 0.19
50 0.2
51 0.23
52 0.24
53 0.26
54 0.31
55 0.35
56 0.44
57 0.54
58 0.59
59 0.62
60 0.62
61 0.65
62 0.66
63 0.68
64 0.67
65 0.57
66 0.55
67 0.54
68 0.52
69 0.42
70 0.34
71 0.26
72 0.19
73 0.18
74 0.14
75 0.12
76 0.1
77 0.09
78 0.09