Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EJN2

Protein Details
Accession A0A1B8EJN2   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-58PFLSHYHRRRHPHRDRPSDGBasic
NLS Segment(s)
PositionSequence
47-56RRHPHRDRPS
62-62R
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MESHPPTTPHHTADSHASASSAARVPYGVRSEVSFSHLPFLSHYHRRRHPHRDRPSDGPHDRARLARRRTTACSTSGRAEDEAKSQHDPVQLFPLQDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.28
4 0.25
5 0.2
6 0.2
7 0.2
8 0.15
9 0.12
10 0.1
11 0.11
12 0.11
13 0.15
14 0.17
15 0.16
16 0.14
17 0.15
18 0.17
19 0.17
20 0.21
21 0.18
22 0.16
23 0.18
24 0.18
25 0.17
26 0.16
27 0.2
28 0.21
29 0.29
30 0.34
31 0.39
32 0.46
33 0.53
34 0.6
35 0.67
36 0.72
37 0.74
38 0.79
39 0.81
40 0.78
41 0.78
42 0.77
43 0.76
44 0.67
45 0.62
46 0.54
47 0.48
48 0.44
49 0.42
50 0.42
51 0.41
52 0.45
53 0.46
54 0.48
55 0.5
56 0.55
57 0.57
58 0.53
59 0.48
60 0.48
61 0.44
62 0.43
63 0.4
64 0.36
65 0.3
66 0.3
67 0.27
68 0.26
69 0.27
70 0.26
71 0.27
72 0.26
73 0.28
74 0.3
75 0.3
76 0.27
77 0.31
78 0.3
79 0.28