Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8F6L3

Protein Details
Accession A0A1B8F6L3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-41SPVAPRKRAAPKPKANTTAKHydrophilic
NLS Segment(s)
PositionSequence
23-106PVAPRKRAAPKPKANTTAKRAPKKAAAAGSKPVGVKKSAAAPKAGAAAAVKAKVEKVKKVVENKAAPAKKEKAAAAPKTVVAKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MARETRAATGNSRPRIFEAPPSPVAPRKRAAPKPKANTTAKRAPKKAAAAGSKPVGVKKSAAAPKAGAAAAVKAKVEKVKKVVENKAAPAKKEKAAAAPKTVVAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.44
4 0.44
5 0.4
6 0.38
7 0.39
8 0.4
9 0.39
10 0.41
11 0.44
12 0.39
13 0.37
14 0.39
15 0.46
16 0.54
17 0.61
18 0.65
19 0.7
20 0.75
21 0.8
22 0.8
23 0.77
24 0.75
25 0.72
26 0.71
27 0.7
28 0.7
29 0.64
30 0.59
31 0.57
32 0.53
33 0.5
34 0.47
35 0.42
36 0.36
37 0.36
38 0.34
39 0.3
40 0.27
41 0.24
42 0.18
43 0.15
44 0.14
45 0.12
46 0.19
47 0.21
48 0.22
49 0.22
50 0.21
51 0.21
52 0.22
53 0.21
54 0.13
55 0.09
56 0.1
57 0.1
58 0.11
59 0.1
60 0.09
61 0.1
62 0.16
63 0.19
64 0.22
65 0.26
66 0.33
67 0.39
68 0.47
69 0.53
70 0.56
71 0.57
72 0.58
73 0.63
74 0.59
75 0.54
76 0.54
77 0.52
78 0.46
79 0.47
80 0.43
81 0.43
82 0.49
83 0.51
84 0.49
85 0.47
86 0.46