Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EVY9

Protein Details
Accession A0A1B8EVY9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-94NPTEKGTSRKKSTQKKTEKQHAAHNKSHydrophilic
NLS Segment(s)
PositionSequence
75-107SRKKSTQKKTEKQHAAHNKSTEKKPAHKKLKTK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPSQKQNNGKSGSNVPYNPGPSTSFSLATIGTASVGPNYDPLAQWAASTFTRDNPVTDFLFEIGPVENPTEKGTSRKKSTQKKTEKQHAAHNKSTEKKPAHKKLKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.41
4 0.41
5 0.37
6 0.32
7 0.28
8 0.25
9 0.3
10 0.28
11 0.24
12 0.21
13 0.21
14 0.19
15 0.17
16 0.14
17 0.09
18 0.07
19 0.06
20 0.06
21 0.05
22 0.06
23 0.06
24 0.06
25 0.08
26 0.08
27 0.07
28 0.09
29 0.1
30 0.1
31 0.1
32 0.1
33 0.11
34 0.1
35 0.13
36 0.12
37 0.11
38 0.15
39 0.15
40 0.15
41 0.14
42 0.17
43 0.15
44 0.15
45 0.14
46 0.11
47 0.1
48 0.1
49 0.09
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.1
57 0.11
58 0.11
59 0.18
60 0.26
61 0.33
62 0.39
63 0.47
64 0.55
65 0.64
66 0.75
67 0.78
68 0.81
69 0.83
70 0.87
71 0.89
72 0.89
73 0.82
74 0.82
75 0.82
76 0.79
77 0.76
78 0.73
79 0.7
80 0.68
81 0.7
82 0.69
83 0.65
84 0.67
85 0.71
86 0.76
87 0.78