Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8FAD8

Protein Details
Accession A0A1B8FAD8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-43FAKVSKTRNRPEARRVYKRDRKSPLFFHydrophilic
NLS Segment(s)
PositionSequence
22-37KTRNRPEARRVYKRDR
Subcellular Location(s) mito 10.5, mito_nucl 10.333, nucl 9, cyto_nucl 7.833, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MFFIPPPPGSPKQRDIFAKVSKTRNRPEARRVYKRDRKSPLFFSSSDPQEKPTVHLPPPPPFSLDTFDKQTEVDTSWSRCGHITQTTDGCPFSRNSRTPGRDCPEYWFRHRHRQGFCPACAARSRWSWLCGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.59
4 0.59
5 0.61
6 0.6
7 0.65
8 0.66
9 0.69
10 0.7
11 0.72
12 0.73
13 0.71
14 0.74
15 0.76
16 0.78
17 0.8
18 0.82
19 0.83
20 0.84
21 0.86
22 0.85
23 0.83
24 0.81
25 0.77
26 0.76
27 0.71
28 0.65
29 0.57
30 0.53
31 0.5
32 0.46
33 0.44
34 0.37
35 0.33
36 0.33
37 0.32
38 0.29
39 0.28
40 0.28
41 0.25
42 0.31
43 0.32
44 0.35
45 0.38
46 0.36
47 0.32
48 0.28
49 0.28
50 0.27
51 0.26
52 0.23
53 0.22
54 0.22
55 0.21
56 0.2
57 0.18
58 0.15
59 0.13
60 0.13
61 0.12
62 0.14
63 0.17
64 0.17
65 0.17
66 0.17
67 0.17
68 0.17
69 0.2
70 0.2
71 0.2
72 0.22
73 0.23
74 0.24
75 0.23
76 0.2
77 0.17
78 0.16
79 0.19
80 0.25
81 0.26
82 0.3
83 0.39
84 0.45
85 0.48
86 0.56
87 0.56
88 0.53
89 0.52
90 0.54
91 0.53
92 0.53
93 0.55
94 0.55
95 0.55
96 0.61
97 0.69
98 0.7
99 0.67
100 0.7
101 0.74
102 0.71
103 0.66
104 0.64
105 0.56
106 0.51
107 0.49
108 0.44
109 0.39
110 0.36
111 0.42
112 0.37
113 0.39