Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZBH2

Protein Details
Accession C7ZBH2   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
129-156NERRILRLKKMLRRSRKQTRPRGAQLPSHydrophilic
168-190QTPAAKPCLKRKRSKVLFEPTKMHydrophilic
NLS Segment(s)
PositionSequence
132-150RILRLKKMLRRSRKQTRPR
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
KEGG nhe:NECHADRAFT_83179  -  
Amino Acid Sequences MATPPTLSTPRLSYPWTFSLAKVLENSVGPLPCPVATQGAELVPPPETPALRYPPPDPAFVETLTERLEKLAWRQRIRINVYGVDFAEEWPISRTPRLLAEEAAARRIAFLEKDLHLDSSSTSESEGENERRILRLKKMLRRSRKQTRPRGAQLPSPQSTTEEEAGEQTPAAKPCLKRKRSKVLFEPTKMAKTSKELAVSRINLPSTANGGEAPMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.37
4 0.34
5 0.3
6 0.35
7 0.33
8 0.31
9 0.27
10 0.25
11 0.22
12 0.21
13 0.23
14 0.18
15 0.18
16 0.16
17 0.15
18 0.15
19 0.13
20 0.14
21 0.13
22 0.13
23 0.13
24 0.14
25 0.15
26 0.14
27 0.14
28 0.13
29 0.13
30 0.1
31 0.09
32 0.1
33 0.11
34 0.11
35 0.14
36 0.19
37 0.23
38 0.25
39 0.28
40 0.28
41 0.35
42 0.37
43 0.36
44 0.32
45 0.3
46 0.3
47 0.27
48 0.28
49 0.18
50 0.18
51 0.17
52 0.16
53 0.13
54 0.11
55 0.12
56 0.1
57 0.18
58 0.25
59 0.31
60 0.34
61 0.39
62 0.42
63 0.49
64 0.53
65 0.51
66 0.45
67 0.4
68 0.38
69 0.35
70 0.31
71 0.24
72 0.19
73 0.14
74 0.13
75 0.1
76 0.09
77 0.1
78 0.11
79 0.1
80 0.11
81 0.11
82 0.1
83 0.14
84 0.16
85 0.15
86 0.14
87 0.15
88 0.19
89 0.18
90 0.18
91 0.15
92 0.12
93 0.11
94 0.11
95 0.1
96 0.06
97 0.07
98 0.09
99 0.09
100 0.12
101 0.13
102 0.13
103 0.12
104 0.12
105 0.11
106 0.1
107 0.1
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.14
114 0.13
115 0.14
116 0.16
117 0.16
118 0.17
119 0.21
120 0.23
121 0.23
122 0.31
123 0.37
124 0.44
125 0.55
126 0.63
127 0.69
128 0.75
129 0.81
130 0.82
131 0.85
132 0.87
133 0.87
134 0.88
135 0.87
136 0.85
137 0.83
138 0.75
139 0.72
140 0.7
141 0.67
142 0.58
143 0.51
144 0.44
145 0.38
146 0.37
147 0.33
148 0.27
149 0.19
150 0.18
151 0.18
152 0.18
153 0.16
154 0.13
155 0.11
156 0.12
157 0.13
158 0.15
159 0.18
160 0.22
161 0.33
162 0.44
163 0.51
164 0.57
165 0.66
166 0.75
167 0.79
168 0.85
169 0.84
170 0.84
171 0.85
172 0.79
173 0.77
174 0.7
175 0.66
176 0.58
177 0.5
178 0.42
179 0.38
180 0.39
181 0.36
182 0.4
183 0.36
184 0.38
185 0.44
186 0.45
187 0.42
188 0.42
189 0.38
190 0.3
191 0.31
192 0.28
193 0.24
194 0.22
195 0.19
196 0.15