Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YTB8

Protein Details
Accession C7YTB8   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-46HSMTCHGKTQKKDNPRCTVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018306  Phage_T5_Orf172_DNA-bd  
KEGG nhe:NECHADRAFT_80249  -  
Pfam View protein in Pfam  
PF10544  T5orf172  
Amino Acid Sequences MATSPSVTTWPATASALRELLGMDACHSMTCHGKTQKKDNPRCTVIISKKDCNEAAKLLDQIVELGSFKAAQSILSDLAYLIMCKNKRIGHGDKFGPSQISKWRVKLESIPIPSVENEEQEEDASSEDEAEDDSPTPPLSVWHSDSETDEDTSTQEDTPDLASQTPPSTSDSRKTTKETKIVHKFERYSIVRSTTFINKKIRKLLLRPLLDREKQVDGYIYTYTFPESYHDAAPYLKIGYAKDVQARMSCWERQCRYRPKVLVQQSADHYVKIEGLVHAQLINQRKVEATGCPVCSVRHNEWFSASSLDASRAVSLWASWMRQMPYDEEGQLKSKWKARIEGLDMSDAACWEELVNAIYVDDEDDLSEEDEFQWSTDDESHHSAEEYEIYESEDEYGDKSGSDDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.21
4 0.2
5 0.18
6 0.17
7 0.17
8 0.17
9 0.14
10 0.11
11 0.12
12 0.12
13 0.12
14 0.12
15 0.13
16 0.17
17 0.2
18 0.27
19 0.35
20 0.42
21 0.49
22 0.59
23 0.67
24 0.71
25 0.79
26 0.8
27 0.8
28 0.79
29 0.74
30 0.69
31 0.7
32 0.68
33 0.68
34 0.65
35 0.62
36 0.6
37 0.63
38 0.6
39 0.53
40 0.47
41 0.41
42 0.38
43 0.34
44 0.31
45 0.27
46 0.25
47 0.22
48 0.18
49 0.15
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.07
56 0.09
57 0.09
58 0.08
59 0.09
60 0.11
61 0.12
62 0.11
63 0.12
64 0.09
65 0.1
66 0.1
67 0.09
68 0.09
69 0.14
70 0.14
71 0.16
72 0.21
73 0.23
74 0.28
75 0.35
76 0.42
77 0.44
78 0.52
79 0.54
80 0.53
81 0.52
82 0.48
83 0.44
84 0.36
85 0.31
86 0.31
87 0.36
88 0.35
89 0.37
90 0.42
91 0.4
92 0.43
93 0.45
94 0.45
95 0.45
96 0.45
97 0.42
98 0.36
99 0.36
100 0.33
101 0.32
102 0.25
103 0.18
104 0.16
105 0.16
106 0.16
107 0.15
108 0.15
109 0.1
110 0.1
111 0.09
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.07
121 0.07
122 0.08
123 0.08
124 0.07
125 0.08
126 0.11
127 0.14
128 0.16
129 0.18
130 0.2
131 0.2
132 0.21
133 0.23
134 0.21
135 0.17
136 0.15
137 0.13
138 0.12
139 0.12
140 0.12
141 0.09
142 0.08
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.08
149 0.08
150 0.09
151 0.1
152 0.1
153 0.1
154 0.12
155 0.15
156 0.17
157 0.23
158 0.27
159 0.31
160 0.33
161 0.38
162 0.42
163 0.45
164 0.51
165 0.51
166 0.55
167 0.61
168 0.64
169 0.63
170 0.61
171 0.56
172 0.5
173 0.54
174 0.45
175 0.38
176 0.35
177 0.34
178 0.29
179 0.28
180 0.29
181 0.28
182 0.3
183 0.32
184 0.39
185 0.4
186 0.43
187 0.49
188 0.52
189 0.47
190 0.47
191 0.51
192 0.5
193 0.49
194 0.47
195 0.47
196 0.49
197 0.46
198 0.43
199 0.37
200 0.31
201 0.27
202 0.26
203 0.21
204 0.14
205 0.15
206 0.14
207 0.11
208 0.09
209 0.09
210 0.09
211 0.08
212 0.08
213 0.08
214 0.1
215 0.12
216 0.13
217 0.13
218 0.13
219 0.13
220 0.13
221 0.12
222 0.09
223 0.09
224 0.09
225 0.09
226 0.12
227 0.14
228 0.15
229 0.18
230 0.19
231 0.19
232 0.19
233 0.2
234 0.19
235 0.21
236 0.24
237 0.24
238 0.32
239 0.35
240 0.41
241 0.5
242 0.57
243 0.58
244 0.63
245 0.63
246 0.61
247 0.67
248 0.68
249 0.66
250 0.58
251 0.57
252 0.51
253 0.54
254 0.47
255 0.37
256 0.3
257 0.22
258 0.2
259 0.16
260 0.14
261 0.08
262 0.09
263 0.09
264 0.09
265 0.08
266 0.09
267 0.13
268 0.18
269 0.2
270 0.19
271 0.19
272 0.19
273 0.2
274 0.21
275 0.18
276 0.19
277 0.21
278 0.22
279 0.23
280 0.24
281 0.23
282 0.27
283 0.32
284 0.3
285 0.34
286 0.35
287 0.35
288 0.37
289 0.37
290 0.33
291 0.29
292 0.24
293 0.17
294 0.16
295 0.16
296 0.15
297 0.13
298 0.13
299 0.1
300 0.1
301 0.09
302 0.08
303 0.11
304 0.12
305 0.12
306 0.14
307 0.18
308 0.19
309 0.22
310 0.24
311 0.23
312 0.23
313 0.25
314 0.24
315 0.22
316 0.23
317 0.23
318 0.25
319 0.27
320 0.29
321 0.33
322 0.39
323 0.4
324 0.44
325 0.47
326 0.52
327 0.52
328 0.54
329 0.49
330 0.45
331 0.41
332 0.35
333 0.3
334 0.22
335 0.17
336 0.1
337 0.08
338 0.06
339 0.06
340 0.07
341 0.07
342 0.08
343 0.07
344 0.07
345 0.07
346 0.07
347 0.07
348 0.07
349 0.06
350 0.06
351 0.07
352 0.08
353 0.08
354 0.08
355 0.08
356 0.08
357 0.1
358 0.1
359 0.09
360 0.1
361 0.09
362 0.11
363 0.14
364 0.16
365 0.18
366 0.22
367 0.23
368 0.22
369 0.22
370 0.21
371 0.19
372 0.19
373 0.17
374 0.15
375 0.13
376 0.15
377 0.14
378 0.14
379 0.14
380 0.13
381 0.12
382 0.11
383 0.13
384 0.11
385 0.11
386 0.11
387 0.13