Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EVB7

Protein Details
Accession A0A1B8EVB7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-114SPSPPPTPKEKPLRTKRGRRAPDFLHydrophilic
NLS Segment(s)
PositionSequence
97-109PKEKPLRTKRGRR
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPSKRTPQANHHPAATAPPPTLPPSVEEAYRRKCIQLRHRMKTVEEANDASRIRLLRMRRGIEKMRLERAFLLEQLAKRTSTNVEDSDGSPSPPPTPKEKPLRTKRGRRAPDFLQDQPDAASGLSHGNGSRQASFAGSANGRSASNPSNTAAAGASITRSSQANGTSAPRQPRSGFDVFVKSMRSVLLVANRQKIKEGTYDVDQDLARKWTNLGSEKQGDYCRRFEEGEYEGWEEAESRDKKRLAEGDDTDADIDVAVEAEDVEMGEESGEGERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.35
4 0.26
5 0.25
6 0.25
7 0.27
8 0.29
9 0.23
10 0.21
11 0.25
12 0.26
13 0.28
14 0.31
15 0.36
16 0.41
17 0.47
18 0.45
19 0.44
20 0.46
21 0.52
22 0.57
23 0.6
24 0.65
25 0.66
26 0.72
27 0.7
28 0.68
29 0.67
30 0.63
31 0.58
32 0.5
33 0.44
34 0.38
35 0.41
36 0.39
37 0.3
38 0.27
39 0.21
40 0.21
41 0.23
42 0.25
43 0.29
44 0.37
45 0.41
46 0.44
47 0.51
48 0.55
49 0.59
50 0.64
51 0.6
52 0.61
53 0.57
54 0.53
55 0.48
56 0.45
57 0.38
58 0.29
59 0.27
60 0.21
61 0.22
62 0.24
63 0.24
64 0.2
65 0.19
66 0.2
67 0.19
68 0.19
69 0.22
70 0.19
71 0.19
72 0.2
73 0.21
74 0.24
75 0.22
76 0.19
77 0.17
78 0.16
79 0.17
80 0.2
81 0.22
82 0.25
83 0.31
84 0.38
85 0.48
86 0.56
87 0.64
88 0.7
89 0.78
90 0.81
91 0.85
92 0.87
93 0.87
94 0.87
95 0.81
96 0.77
97 0.7
98 0.69
99 0.64
100 0.56
101 0.5
102 0.42
103 0.37
104 0.31
105 0.26
106 0.18
107 0.12
108 0.1
109 0.05
110 0.06
111 0.06
112 0.06
113 0.05
114 0.06
115 0.08
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.1
122 0.09
123 0.09
124 0.08
125 0.08
126 0.09
127 0.09
128 0.09
129 0.09
130 0.11
131 0.11
132 0.12
133 0.13
134 0.13
135 0.13
136 0.12
137 0.13
138 0.1
139 0.08
140 0.07
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.08
149 0.09
150 0.09
151 0.1
152 0.13
153 0.16
154 0.2
155 0.25
156 0.25
157 0.27
158 0.27
159 0.29
160 0.33
161 0.31
162 0.29
163 0.26
164 0.28
165 0.27
166 0.27
167 0.26
168 0.19
169 0.18
170 0.16
171 0.14
172 0.11
173 0.12
174 0.17
175 0.22
176 0.25
177 0.32
178 0.34
179 0.33
180 0.35
181 0.34
182 0.29
183 0.27
184 0.28
185 0.24
186 0.25
187 0.28
188 0.26
189 0.28
190 0.26
191 0.22
192 0.2
193 0.2
194 0.17
195 0.15
196 0.15
197 0.15
198 0.21
199 0.25
200 0.26
201 0.29
202 0.33
203 0.34
204 0.37
205 0.41
206 0.42
207 0.41
208 0.41
209 0.37
210 0.36
211 0.36
212 0.33
213 0.31
214 0.28
215 0.27
216 0.27
217 0.26
218 0.23
219 0.22
220 0.21
221 0.17
222 0.15
223 0.21
224 0.21
225 0.22
226 0.29
227 0.31
228 0.32
229 0.38
230 0.44
231 0.39
232 0.45
233 0.46
234 0.45
235 0.44
236 0.44
237 0.37
238 0.31
239 0.25
240 0.16
241 0.13
242 0.06
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.05
254 0.04
255 0.05