Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8ETJ2

Protein Details
Accession A0A1B8ETJ2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
288-307TGSPAKKPGKAAPPAKKKGKBasic
NLS Segment(s)
PositionSequence
290-307SPAKKPGKAAPPAKKKGK
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037830  ZZZ3  
Amino Acid Sequences MPALTVETTSPHSSPHPALQNGALPYAPRRSASPQHSRPSSPPQPPYSPITPTLAAARLDTNVPPLPQQPLRTYTHSRPDATFIPPPPAPLEVIDFDSNTDVLAVKSAISVLQLQKKKAAQDIRTLQRFKNQAMQDPEAFLRAADMGEIRTDGDATFPEDSEEEDEDDVDGDVEMNCIEERATKVEEHKEASMKNGTAHTKAHTKAHSSFPPLPVPQKVVKVPPINWAQYGVIGDSLDKLHNDQLQHPTPGSPARLGPDGQVLNGYTGNEFEMRDPSPQSPAGTLKGTGSPAKKPGKAAPPAKKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.38
4 0.36
5 0.38
6 0.38
7 0.41
8 0.37
9 0.35
10 0.27
11 0.2
12 0.23
13 0.27
14 0.26
15 0.22
16 0.24
17 0.31
18 0.39
19 0.47
20 0.55
21 0.57
22 0.64
23 0.68
24 0.68
25 0.66
26 0.68
27 0.68
28 0.65
29 0.64
30 0.62
31 0.62
32 0.62
33 0.63
34 0.57
35 0.51
36 0.45
37 0.41
38 0.35
39 0.31
40 0.31
41 0.27
42 0.23
43 0.21
44 0.2
45 0.16
46 0.17
47 0.16
48 0.17
49 0.16
50 0.16
51 0.17
52 0.17
53 0.23
54 0.25
55 0.29
56 0.28
57 0.32
58 0.36
59 0.41
60 0.46
61 0.46
62 0.52
63 0.53
64 0.51
65 0.47
66 0.47
67 0.43
68 0.41
69 0.39
70 0.31
71 0.32
72 0.29
73 0.29
74 0.26
75 0.24
76 0.21
77 0.16
78 0.18
79 0.14
80 0.17
81 0.16
82 0.15
83 0.14
84 0.14
85 0.13
86 0.1
87 0.09
88 0.06
89 0.05
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.08
98 0.11
99 0.19
100 0.22
101 0.23
102 0.27
103 0.29
104 0.3
105 0.34
106 0.37
107 0.32
108 0.38
109 0.46
110 0.49
111 0.54
112 0.54
113 0.48
114 0.47
115 0.48
116 0.4
117 0.4
118 0.33
119 0.33
120 0.37
121 0.39
122 0.33
123 0.32
124 0.31
125 0.23
126 0.22
127 0.15
128 0.1
129 0.07
130 0.06
131 0.05
132 0.05
133 0.04
134 0.04
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.06
143 0.06
144 0.06
145 0.07
146 0.07
147 0.07
148 0.09
149 0.09
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.05
157 0.04
158 0.03
159 0.03
160 0.04
161 0.03
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.06
168 0.09
169 0.1
170 0.11
171 0.15
172 0.2
173 0.22
174 0.23
175 0.24
176 0.24
177 0.23
178 0.25
179 0.25
180 0.21
181 0.2
182 0.23
183 0.23
184 0.22
185 0.23
186 0.23
187 0.25
188 0.26
189 0.3
190 0.28
191 0.31
192 0.33
193 0.39
194 0.4
195 0.41
196 0.43
197 0.41
198 0.44
199 0.41
200 0.41
201 0.36
202 0.36
203 0.33
204 0.33
205 0.33
206 0.32
207 0.37
208 0.39
209 0.38
210 0.41
211 0.43
212 0.4
213 0.38
214 0.36
215 0.28
216 0.25
217 0.24
218 0.17
219 0.12
220 0.1
221 0.1
222 0.09
223 0.1
224 0.09
225 0.09
226 0.1
227 0.13
228 0.16
229 0.18
230 0.21
231 0.28
232 0.31
233 0.33
234 0.32
235 0.29
236 0.29
237 0.31
238 0.29
239 0.23
240 0.2
241 0.22
242 0.24
243 0.23
244 0.22
245 0.25
246 0.23
247 0.21
248 0.21
249 0.18
250 0.17
251 0.18
252 0.17
253 0.1
254 0.1
255 0.12
256 0.11
257 0.11
258 0.11
259 0.14
260 0.15
261 0.18
262 0.21
263 0.21
264 0.24
265 0.26
266 0.26
267 0.26
268 0.27
269 0.28
270 0.28
271 0.27
272 0.24
273 0.25
274 0.27
275 0.29
276 0.29
277 0.31
278 0.38
279 0.45
280 0.46
281 0.48
282 0.54
283 0.57
284 0.64
285 0.69
286 0.71
287 0.74