Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EM29

Protein Details
Accession A0A1B8EM29   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-127ESMQRLQEGRNRRRRPQNPPANEHydrophilic
NLS Segment(s)
PositionSequence
63-66RPRP
Subcellular Location(s) plas 13, E.R. 4, golg 3, vacu 3, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSWSSILPSNLEYIEVWITRLFLILAGLVLGPWLLLVVYDFFVYIFRIVGYEVPFFGGRARNRPRPRAPSLSERPSGEPREFRISVPAIPIPPEAGQQDEQGGAESMQRLQEGRNRRRRPQNPPANE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.15
4 0.13
5 0.13
6 0.12
7 0.12
8 0.1
9 0.07
10 0.07
11 0.06
12 0.05
13 0.05
14 0.05
15 0.04
16 0.04
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.05
33 0.04
34 0.05
35 0.05
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.09
42 0.09
43 0.11
44 0.15
45 0.14
46 0.23
47 0.3
48 0.38
49 0.43
50 0.51
51 0.56
52 0.58
53 0.63
54 0.62
55 0.59
56 0.59
57 0.62
58 0.6
59 0.55
60 0.5
61 0.47
62 0.45
63 0.45
64 0.38
65 0.33
66 0.31
67 0.36
68 0.35
69 0.31
70 0.31
71 0.29
72 0.26
73 0.27
74 0.25
75 0.18
76 0.18
77 0.18
78 0.15
79 0.14
80 0.15
81 0.13
82 0.14
83 0.15
84 0.14
85 0.15
86 0.14
87 0.13
88 0.12
89 0.12
90 0.09
91 0.09
92 0.1
93 0.1
94 0.11
95 0.11
96 0.11
97 0.13
98 0.19
99 0.29
100 0.39
101 0.49
102 0.55
103 0.65
104 0.76
105 0.82
106 0.86
107 0.87