Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8ELB8

Protein Details
Accession A0A1B8ELB8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-35VLPMLGYKKYQKHKARKALKNELAAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 7
Family & Domain DBs
Amino Acid Sequences MAAVVLMAIVVLPMLGYKKYQKHKARKALKNELAAQPEPVEGGHQASRERSGDHPPSYDDTFGSHPSPPYSSNKPPGYIQQPSGNRGLPVGHLPGAYLSPTAVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.08
4 0.15
5 0.23
6 0.33
7 0.43
8 0.53
9 0.63
10 0.73
11 0.81
12 0.86
13 0.86
14 0.87
15 0.88
16 0.84
17 0.79
18 0.73
19 0.67
20 0.61
21 0.53
22 0.44
23 0.33
24 0.27
25 0.21
26 0.16
27 0.11
28 0.07
29 0.09
30 0.09
31 0.1
32 0.1
33 0.11
34 0.13
35 0.13
36 0.15
37 0.14
38 0.2
39 0.24
40 0.24
41 0.24
42 0.23
43 0.26
44 0.26
45 0.24
46 0.17
47 0.14
48 0.16
49 0.17
50 0.17
51 0.14
52 0.14
53 0.15
54 0.17
55 0.17
56 0.21
57 0.27
58 0.31
59 0.39
60 0.41
61 0.42
62 0.42
63 0.46
64 0.47
65 0.43
66 0.41
67 0.41
68 0.42
69 0.43
70 0.44
71 0.39
72 0.32
73 0.29
74 0.26
75 0.19
76 0.19
77 0.19
78 0.16
79 0.15
80 0.15
81 0.15
82 0.15
83 0.14
84 0.11
85 0.08