Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W3F5

Protein Details
Accession G0W3F5    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
208-238SNSNVNNKKTKSNKRPKLKKVKTIEKVPPAVHydrophilic
249-280ISPSSSSEKEKKLKKKIDNKNKNKNKGIWASVHydrophilic
NLS Segment(s)
PositionSequence
215-234KKTKSNKRPKLKKVKTIEKV
256-274EKEKKLKKKIDNKNKNKNK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
KEGG ndi:NDAI_0A01850  -  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSETILIRPTYNNRHNNINNNNNNNTKVTFDSKMVQNTNTNTNSNSNSNKYKVTFGRGGAGNIITSTSQPKPKIIRQGSETPNILQPIYSTGRGGAGNLKRNVDPKITRLAQDVDEDSEEENEIINIIKSRNSQLSNNNNNNNKNDLYTTDDEEDEDFIGSHHHHDKKSLDSEDFINNNELSKLESHLEDGINAVISNVKSHLSAVNSNSNVNNKKTKSNKRPKLKKVKTIEKVPPAVVIGRGGAGNIISPSSSSEKEKKLKKKIDNKNKNKNKGIWASVSSFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.71
4 0.73
5 0.73
6 0.73
7 0.72
8 0.76
9 0.7
10 0.66
11 0.59
12 0.5
13 0.42
14 0.37
15 0.36
16 0.31
17 0.3
18 0.33
19 0.35
20 0.42
21 0.41
22 0.4
23 0.4
24 0.4
25 0.46
26 0.43
27 0.39
28 0.34
29 0.36
30 0.37
31 0.37
32 0.4
33 0.38
34 0.4
35 0.41
36 0.44
37 0.41
38 0.45
39 0.42
40 0.44
41 0.42
42 0.37
43 0.41
44 0.38
45 0.37
46 0.31
47 0.28
48 0.21
49 0.16
50 0.16
51 0.09
52 0.09
53 0.13
54 0.15
55 0.21
56 0.22
57 0.28
58 0.33
59 0.39
60 0.49
61 0.5
62 0.51
63 0.51
64 0.59
65 0.58
66 0.57
67 0.52
68 0.43
69 0.41
70 0.37
71 0.31
72 0.21
73 0.17
74 0.16
75 0.18
76 0.17
77 0.14
78 0.13
79 0.15
80 0.15
81 0.15
82 0.18
83 0.2
84 0.27
85 0.29
86 0.31
87 0.3
88 0.32
89 0.34
90 0.33
91 0.3
92 0.25
93 0.31
94 0.31
95 0.31
96 0.31
97 0.3
98 0.25
99 0.25
100 0.24
101 0.16
102 0.15
103 0.15
104 0.12
105 0.1
106 0.09
107 0.07
108 0.06
109 0.05
110 0.05
111 0.04
112 0.04
113 0.05
114 0.05
115 0.07
116 0.08
117 0.11
118 0.15
119 0.17
120 0.2
121 0.28
122 0.37
123 0.45
124 0.5
125 0.54
126 0.55
127 0.56
128 0.54
129 0.49
130 0.39
131 0.31
132 0.25
133 0.2
134 0.21
135 0.19
136 0.2
137 0.18
138 0.17
139 0.17
140 0.16
141 0.15
142 0.1
143 0.08
144 0.06
145 0.05
146 0.06
147 0.06
148 0.08
149 0.15
150 0.18
151 0.18
152 0.22
153 0.24
154 0.28
155 0.33
156 0.33
157 0.27
158 0.25
159 0.27
160 0.28
161 0.27
162 0.23
163 0.2
164 0.17
165 0.17
166 0.16
167 0.13
168 0.1
169 0.1
170 0.1
171 0.09
172 0.1
173 0.1
174 0.12
175 0.12
176 0.11
177 0.11
178 0.09
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.07
185 0.08
186 0.08
187 0.08
188 0.09
189 0.12
190 0.12
191 0.16
192 0.18
193 0.25
194 0.25
195 0.27
196 0.28
197 0.33
198 0.34
199 0.35
200 0.4
201 0.35
202 0.43
203 0.52
204 0.61
205 0.66
206 0.73
207 0.79
208 0.82
209 0.91
210 0.93
211 0.94
212 0.93
213 0.91
214 0.91
215 0.91
216 0.88
217 0.87
218 0.85
219 0.82
220 0.76
221 0.66
222 0.57
223 0.48
224 0.41
225 0.32
226 0.23
227 0.15
228 0.13
229 0.12
230 0.1
231 0.09
232 0.07
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06
238 0.1
239 0.14
240 0.16
241 0.22
242 0.28
243 0.37
244 0.46
245 0.55
246 0.62
247 0.69
248 0.77
249 0.81
250 0.85
251 0.87
252 0.9
253 0.92
254 0.93
255 0.94
256 0.94
257 0.94
258 0.92
259 0.88
260 0.86
261 0.84
262 0.79
263 0.73
264 0.67
265 0.61