Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8F976

Protein Details
Accession A0A1B8F976   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
123-144PVGGKVKQKINRKIKQETKLETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009083  TFIIA_a-hlx  
IPR009088  TFIIA_b-brl  
IPR003194  TFIIA_gsu  
IPR015871  TFIIA_gsu_C  
Gene Ontology GO:0005672  C:transcription factor TFIIA complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF02751  TFIIA_gamma_C  
Amino Acid Sequences MASSNVESSAYFHTSICKTLCDTIDDLICAGRIEPQLGAKILKNFMPNVKKAFAEHVREVVNMKGRLQYYRNFENKWWWVVRDCSVKLRTGVDVEMLYVDKLRIVGYPPSDEPNGKNGGGLEPVGGKVKQKINRKIKQETKLETKQEVKKEVKQETE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.24
4 0.21
5 0.21
6 0.25
7 0.27
8 0.24
9 0.24
10 0.23
11 0.23
12 0.21
13 0.19
14 0.15
15 0.14
16 0.1
17 0.09
18 0.11
19 0.1
20 0.11
21 0.12
22 0.13
23 0.15
24 0.16
25 0.17
26 0.16
27 0.18
28 0.19
29 0.21
30 0.21
31 0.21
32 0.27
33 0.31
34 0.31
35 0.32
36 0.32
37 0.3
38 0.29
39 0.35
40 0.34
41 0.34
42 0.33
43 0.32
44 0.31
45 0.31
46 0.31
47 0.26
48 0.26
49 0.21
50 0.2
51 0.21
52 0.21
53 0.23
54 0.24
55 0.27
56 0.26
57 0.34
58 0.36
59 0.34
60 0.34
61 0.39
62 0.38
63 0.37
64 0.32
65 0.25
66 0.24
67 0.24
68 0.28
69 0.26
70 0.25
71 0.27
72 0.28
73 0.28
74 0.27
75 0.26
76 0.23
77 0.18
78 0.17
79 0.12
80 0.11
81 0.09
82 0.09
83 0.08
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.08
92 0.11
93 0.12
94 0.16
95 0.17
96 0.2
97 0.21
98 0.22
99 0.21
100 0.22
101 0.24
102 0.21
103 0.2
104 0.18
105 0.17
106 0.17
107 0.16
108 0.12
109 0.09
110 0.1
111 0.12
112 0.12
113 0.12
114 0.17
115 0.25
116 0.32
117 0.42
118 0.52
119 0.6
120 0.68
121 0.74
122 0.79
123 0.81
124 0.82
125 0.81
126 0.78
127 0.77
128 0.78
129 0.75
130 0.71
131 0.71
132 0.69
133 0.68
134 0.69
135 0.66
136 0.65
137 0.69