Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8ERQ2

Protein Details
Accession A0A1B8ERQ2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPSRSTTAKKPRTPRKKNAAVAPVEHydrophilic
NLS Segment(s)
PositionSequence
10-18KKPRTPRKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MAPSRSTTAKKPRTPRKKNAAVAPVEEPVNEHAKEPTRELINNNAVITCNEYESSKSKLESNAYPSKEIDNNELLHQLKEAQGPYVAAANETLVEDDIDANEPIIPNANEFENKEFSREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.9
5 0.88
6 0.86
7 0.83
8 0.75
9 0.68
10 0.6
11 0.51
12 0.41
13 0.33
14 0.25
15 0.2
16 0.21
17 0.18
18 0.16
19 0.17
20 0.23
21 0.25
22 0.26
23 0.27
24 0.26
25 0.27
26 0.28
27 0.32
28 0.31
29 0.31
30 0.28
31 0.24
32 0.22
33 0.2
34 0.21
35 0.14
36 0.1
37 0.09
38 0.1
39 0.11
40 0.14
41 0.17
42 0.15
43 0.16
44 0.17
45 0.19
46 0.21
47 0.21
48 0.26
49 0.29
50 0.29
51 0.29
52 0.28
53 0.28
54 0.28
55 0.27
56 0.24
57 0.2
58 0.2
59 0.19
60 0.22
61 0.21
62 0.18
63 0.17
64 0.14
65 0.13
66 0.15
67 0.14
68 0.11
69 0.11
70 0.11
71 0.11
72 0.13
73 0.12
74 0.09
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.13
92 0.12
93 0.11
94 0.13
95 0.16
96 0.18
97 0.2
98 0.24
99 0.27
100 0.27