Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EJL9

Protein Details
Accession A0A1B8EJL9   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAVSKKKSGKPKSLSHGRPPTVHydrophilic
NLS Segment(s)
PositionSequence
5-16KKKSGKPKSLSH
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAVSKKKSGKPKSLSHGRPPTVKTPPSLSSKATRTLIRAHHTLEKQKAIAQKAGDAIKVADLERQIAKQGGIEKYQTASLIGQGNERGGDSSKILMDWLKPIISSLKAKTGEQKLRLLEVGALSTTNACSRSGLFDTERIDLNSQAQGITQQDFMERPLPKLSNEKFEIISLSLVLNYVPDAVSRGEMLKRTLQFLRSPLGESEEELQTVFPALFLVLPAPCVSNSRYMDEPKLEAILTSLGYVKVHKKLSNKLVYYLWRAVDLTPKAKREQFKKVEVRAGGTRNNFAIILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.85
4 0.79
5 0.78
6 0.73
7 0.71
8 0.69
9 0.64
10 0.57
11 0.53
12 0.54
13 0.54
14 0.52
15 0.48
16 0.46
17 0.48
18 0.51
19 0.49
20 0.45
21 0.41
22 0.45
23 0.48
24 0.46
25 0.45
26 0.42
27 0.46
28 0.5
29 0.55
30 0.53
31 0.51
32 0.46
33 0.47
34 0.49
35 0.44
36 0.43
37 0.35
38 0.32
39 0.32
40 0.33
41 0.29
42 0.23
43 0.2
44 0.17
45 0.18
46 0.15
47 0.13
48 0.12
49 0.14
50 0.15
51 0.15
52 0.15
53 0.15
54 0.15
55 0.15
56 0.21
57 0.21
58 0.21
59 0.22
60 0.21
61 0.21
62 0.22
63 0.19
64 0.14
65 0.12
66 0.13
67 0.15
68 0.15
69 0.15
70 0.15
71 0.15
72 0.14
73 0.14
74 0.12
75 0.09
76 0.1
77 0.09
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.1
85 0.11
86 0.1
87 0.09
88 0.1
89 0.12
90 0.14
91 0.17
92 0.16
93 0.22
94 0.23
95 0.24
96 0.3
97 0.37
98 0.4
99 0.4
100 0.43
101 0.37
102 0.37
103 0.37
104 0.3
105 0.22
106 0.16
107 0.13
108 0.08
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.06
116 0.07
117 0.07
118 0.1
119 0.11
120 0.13
121 0.13
122 0.15
123 0.17
124 0.17
125 0.18
126 0.15
127 0.15
128 0.13
129 0.14
130 0.12
131 0.1
132 0.08
133 0.07
134 0.08
135 0.08
136 0.09
137 0.08
138 0.07
139 0.08
140 0.08
141 0.09
142 0.14
143 0.14
144 0.14
145 0.17
146 0.18
147 0.19
148 0.28
149 0.28
150 0.29
151 0.31
152 0.31
153 0.28
154 0.27
155 0.27
156 0.19
157 0.17
158 0.1
159 0.08
160 0.07
161 0.06
162 0.06
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.06
171 0.07
172 0.08
173 0.1
174 0.11
175 0.13
176 0.17
177 0.18
178 0.21
179 0.23
180 0.23
181 0.24
182 0.25
183 0.26
184 0.22
185 0.23
186 0.2
187 0.22
188 0.2
189 0.18
190 0.19
191 0.16
192 0.15
193 0.13
194 0.13
195 0.09
196 0.09
197 0.08
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.06
207 0.07
208 0.07
209 0.1
210 0.11
211 0.18
212 0.2
213 0.23
214 0.27
215 0.29
216 0.33
217 0.33
218 0.33
219 0.26
220 0.25
221 0.21
222 0.17
223 0.15
224 0.12
225 0.1
226 0.09
227 0.09
228 0.09
229 0.09
230 0.13
231 0.16
232 0.22
233 0.26
234 0.3
235 0.35
236 0.44
237 0.54
238 0.6
239 0.58
240 0.55
241 0.56
242 0.56
243 0.56
244 0.52
245 0.42
246 0.34
247 0.33
248 0.3
249 0.33
250 0.33
251 0.35
252 0.37
253 0.4
254 0.44
255 0.49
256 0.57
257 0.56
258 0.62
259 0.62
260 0.67
261 0.73
262 0.74
263 0.75
264 0.69
265 0.67
266 0.63
267 0.6
268 0.57
269 0.51
270 0.48
271 0.4
272 0.4