Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8FA07

Protein Details
Accession A0A1B8FA07    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-72MPRSRSRSPAPRRSPPRRRSRSPDRQEKPRDRDRDSERERTRDREPRDKPKKSGFKWKEKRRDEDRPEEPKRBasic
NLS Segment(s)
PositionSequence
4-92SRSRSPAPRRSPPRRRSRSPDRQEKPRDRDRDSERERTRDREPRDKPKKSGFKWKEKRRDEDRPEEPKRLERGYRNRSPSPRRREPAAK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MPRSRSRSPAPRRSPPRRRSRSPDRQEKPRDRDRDSERERTRDREPRDKPKKSGFKWKEKRRDEDRPEEPKRLERGYRNRSPSPRRREPAAKGSSVEDKFGVAAKFGPSVADKFGSSSKTEKGATADTSKPPARAAAAAAAAPVASGEPMIIVHINDRLGTKAAIPCLASDPVRLFKAQVAARIGRQPHEIMLKRQGERPFKDQLTLEDYGVSNGVQLDLEIDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.91
4 0.9
5 0.91
6 0.9
7 0.9
8 0.9
9 0.9
10 0.91
11 0.88
12 0.89
13 0.91
14 0.91
15 0.89
16 0.87
17 0.85
18 0.79
19 0.8
20 0.78
21 0.78
22 0.74
23 0.76
24 0.72
25 0.73
26 0.72
27 0.68
28 0.69
29 0.67
30 0.67
31 0.67
32 0.7
33 0.72
34 0.79
35 0.82
36 0.79
37 0.81
38 0.84
39 0.79
40 0.81
41 0.79
42 0.8
43 0.83
44 0.86
45 0.86
46 0.84
47 0.87
48 0.85
49 0.86
50 0.83
51 0.82
52 0.81
53 0.81
54 0.78
55 0.75
56 0.68
57 0.63
58 0.6
59 0.55
60 0.51
61 0.5
62 0.56
63 0.59
64 0.65
65 0.65
66 0.67
67 0.71
68 0.75
69 0.76
70 0.75
71 0.76
72 0.72
73 0.72
74 0.72
75 0.69
76 0.69
77 0.64
78 0.55
79 0.46
80 0.45
81 0.45
82 0.38
83 0.32
84 0.22
85 0.17
86 0.16
87 0.17
88 0.15
89 0.08
90 0.08
91 0.08
92 0.09
93 0.08
94 0.09
95 0.07
96 0.08
97 0.09
98 0.09
99 0.08
100 0.09
101 0.11
102 0.11
103 0.12
104 0.13
105 0.14
106 0.16
107 0.17
108 0.16
109 0.16
110 0.17
111 0.17
112 0.19
113 0.21
114 0.19
115 0.24
116 0.24
117 0.22
118 0.21
119 0.19
120 0.16
121 0.14
122 0.14
123 0.11
124 0.1
125 0.1
126 0.09
127 0.08
128 0.07
129 0.06
130 0.05
131 0.03
132 0.02
133 0.02
134 0.02
135 0.02
136 0.03
137 0.03
138 0.04
139 0.04
140 0.05
141 0.07
142 0.07
143 0.08
144 0.08
145 0.09
146 0.1
147 0.1
148 0.12
149 0.13
150 0.13
151 0.14
152 0.14
153 0.14
154 0.15
155 0.18
156 0.15
157 0.15
158 0.17
159 0.19
160 0.2
161 0.2
162 0.17
163 0.17
164 0.24
165 0.24
166 0.26
167 0.27
168 0.28
169 0.3
170 0.35
171 0.35
172 0.3
173 0.31
174 0.27
175 0.26
176 0.34
177 0.35
178 0.34
179 0.42
180 0.47
181 0.46
182 0.51
183 0.56
184 0.55
185 0.58
186 0.57
187 0.57
188 0.51
189 0.53
190 0.48
191 0.44
192 0.42
193 0.38
194 0.34
195 0.27
196 0.26
197 0.23
198 0.22
199 0.17
200 0.11
201 0.1
202 0.1
203 0.07
204 0.07
205 0.07
206 0.07