Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EI25

Protein Details
Accession A0A1B8EI25    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-68DNSPAARRRRRIFIQTKKKAEFHydrophilic
NLS Segment(s)
PositionSequence
55-55R
Subcellular Location(s) plas 10, mito 6, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038967  Dsc4-like  
IPR013715  DUF1746  
Gene Ontology GO:0044695  C:Dsc E3 ubiquitin ligase complex  
Pfam View protein in Pfam  
PF08508  DUF1746  
Amino Acid Sequences MNDESASAPAAGPGDPQPPPPSDDAAAAEATPTPAATPPPATAGIDDNSPAARRRRRIFIQTKKKAEFIHDILVNLDMLIYAELCFMYYNDCSLFRFLLRSITQLVFLSPAAKPPPIPGPRPFIPALLSTNMLCAFLHLVTARPSGSELTRGYLHGGIIVDFIGQRAPSTKALLVGLDILILVLQLVMLSVHVEEAVLKAALANRDGMTAYIAGGGTGVDPAERGAGDLEMGTGTPGGAMGVEMEMQDLSAPEGAGAEERDVLLAESMRRAEEGGDAGVVDAFYTGNVVVGTFDVVGTVRAQWGGGEGGGRALVMAGQTAGYEWARARGGVTRRLGTMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.21
4 0.24
5 0.25
6 0.28
7 0.29
8 0.3
9 0.26
10 0.28
11 0.27
12 0.25
13 0.23
14 0.2
15 0.18
16 0.14
17 0.13
18 0.11
19 0.08
20 0.07
21 0.08
22 0.1
23 0.12
24 0.14
25 0.14
26 0.17
27 0.19
28 0.18
29 0.18
30 0.2
31 0.18
32 0.17
33 0.16
34 0.14
35 0.14
36 0.15
37 0.19
38 0.25
39 0.32
40 0.39
41 0.44
42 0.53
43 0.59
44 0.68
45 0.74
46 0.77
47 0.8
48 0.82
49 0.86
50 0.8
51 0.77
52 0.68
53 0.62
54 0.59
55 0.51
56 0.48
57 0.4
58 0.38
59 0.34
60 0.32
61 0.26
62 0.18
63 0.14
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.07
75 0.07
76 0.08
77 0.09
78 0.1
79 0.11
80 0.13
81 0.14
82 0.11
83 0.13
84 0.12
85 0.18
86 0.17
87 0.18
88 0.2
89 0.2
90 0.2
91 0.19
92 0.19
93 0.13
94 0.13
95 0.13
96 0.09
97 0.12
98 0.13
99 0.13
100 0.13
101 0.14
102 0.23
103 0.26
104 0.3
105 0.3
106 0.36
107 0.37
108 0.42
109 0.4
110 0.31
111 0.29
112 0.26
113 0.25
114 0.19
115 0.18
116 0.14
117 0.14
118 0.14
119 0.12
120 0.1
121 0.08
122 0.08
123 0.06
124 0.07
125 0.06
126 0.07
127 0.08
128 0.1
129 0.09
130 0.08
131 0.09
132 0.09
133 0.1
134 0.12
135 0.11
136 0.13
137 0.13
138 0.13
139 0.14
140 0.13
141 0.13
142 0.1
143 0.1
144 0.08
145 0.07
146 0.07
147 0.06
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.05
154 0.08
155 0.09
156 0.1
157 0.11
158 0.11
159 0.12
160 0.12
161 0.1
162 0.08
163 0.07
164 0.05
165 0.04
166 0.03
167 0.03
168 0.03
169 0.02
170 0.02
171 0.02
172 0.01
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.06
188 0.07
189 0.08
190 0.09
191 0.08
192 0.09
193 0.09
194 0.08
195 0.07
196 0.07
197 0.06
198 0.06
199 0.06
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.03
207 0.03
208 0.03
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.05
217 0.04
218 0.04
219 0.04
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.05
239 0.04
240 0.05
241 0.05
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.09
254 0.1
255 0.1
256 0.1
257 0.1
258 0.1
259 0.1
260 0.11
261 0.09
262 0.09
263 0.08
264 0.08
265 0.08
266 0.07
267 0.06
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.06
279 0.06
280 0.05
281 0.05
282 0.05
283 0.06
284 0.07
285 0.07
286 0.07
287 0.07
288 0.08
289 0.07
290 0.09
291 0.09
292 0.08
293 0.08
294 0.07
295 0.08
296 0.08
297 0.08
298 0.06
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.05
306 0.05
307 0.08
308 0.08
309 0.09
310 0.1
311 0.14
312 0.15
313 0.15
314 0.16
315 0.21
316 0.27
317 0.33
318 0.38
319 0.37