Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8FAJ3

Protein Details
Accession A0A1B8FAJ3    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-74DLVHPKTGTRKRKRVRRYDKLPALVRBasic
100-119EEGEGEGKKKKKEKKKCVVMBasic
NLS Segment(s)
PositionSequence
56-65GTRKRKRVRR
106-115GKKKKKEKKK
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MDASSAGPSEPEPLKHPHSHYWKTTKKGSIIEKWVLEKNSEGKTVRNVDLVHPKTGTRKRKRVRRYDKLPALVRIASGGARVEGGEGKDGGGDLEEDGEEEGEGEGKKKKKEKKKCVVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.4
4 0.45
5 0.52
6 0.57
7 0.61
8 0.66
9 0.67
10 0.67
11 0.7
12 0.66
13 0.61
14 0.62
15 0.61
16 0.58
17 0.57
18 0.56
19 0.5
20 0.48
21 0.48
22 0.41
23 0.35
24 0.3
25 0.28
26 0.26
27 0.28
28 0.26
29 0.23
30 0.28
31 0.31
32 0.3
33 0.28
34 0.26
35 0.25
36 0.35
37 0.35
38 0.31
39 0.27
40 0.26
41 0.32
42 0.4
43 0.47
44 0.46
45 0.54
46 0.61
47 0.7
48 0.79
49 0.82
50 0.85
51 0.85
52 0.85
53 0.85
54 0.84
55 0.82
56 0.75
57 0.66
58 0.58
59 0.47
60 0.38
61 0.28
62 0.21
63 0.14
64 0.11
65 0.09
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.05
80 0.04
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.07
91 0.09
92 0.16
93 0.21
94 0.29
95 0.37
96 0.48
97 0.56
98 0.68
99 0.77