Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8F3K9

Protein Details
Accession A0A1B8F3K9   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-138TGANWGKKARKRQRAMIKRIIEHydrophilic
NLS Segment(s)
PositionSequence
123-133KKARKRQRAMI
Subcellular Location(s) cyto 11, cyto_nucl 8, cysk 8, pero 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MTELNDLIDTVLGYIVQGFENLKNNAEHYASMSLKEWVRIVTIIGAYLLLRPYLSQWAAKLQSDQHDKEIDADEMATPATGPKAAISANSLRGQVKVPEDSEDDEDTGEAVVAAETTGANWGKKARKRQRAMIKRIIEADEKLRAETEAYDDEEDKDIEQYLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.06
5 0.07
6 0.1
7 0.17
8 0.18
9 0.2
10 0.2
11 0.21
12 0.23
13 0.22
14 0.19
15 0.16
16 0.22
17 0.2
18 0.2
19 0.2
20 0.21
21 0.21
22 0.22
23 0.2
24 0.14
25 0.15
26 0.14
27 0.13
28 0.11
29 0.11
30 0.09
31 0.09
32 0.08
33 0.07
34 0.08
35 0.08
36 0.05
37 0.05
38 0.05
39 0.07
40 0.1
41 0.12
42 0.11
43 0.12
44 0.17
45 0.19
46 0.2
47 0.2
48 0.18
49 0.24
50 0.3
51 0.3
52 0.27
53 0.26
54 0.26
55 0.26
56 0.26
57 0.19
58 0.13
59 0.12
60 0.09
61 0.08
62 0.08
63 0.05
64 0.03
65 0.03
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.05
73 0.07
74 0.09
75 0.12
76 0.13
77 0.15
78 0.14
79 0.15
80 0.16
81 0.16
82 0.17
83 0.15
84 0.15
85 0.16
86 0.17
87 0.18
88 0.2
89 0.18
90 0.15
91 0.13
92 0.13
93 0.11
94 0.09
95 0.07
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.07
105 0.08
106 0.08
107 0.09
108 0.15
109 0.23
110 0.3
111 0.41
112 0.49
113 0.58
114 0.65
115 0.74
116 0.79
117 0.82
118 0.85
119 0.84
120 0.78
121 0.71
122 0.68
123 0.61
124 0.52
125 0.44
126 0.39
127 0.36
128 0.32
129 0.29
130 0.26
131 0.23
132 0.22
133 0.2
134 0.2
135 0.16
136 0.18
137 0.19
138 0.2
139 0.21
140 0.22
141 0.22
142 0.18
143 0.16