Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8EXA1

Protein Details
Accession A0A1B8EXA1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
140-161SIDRTGKVRRRWSPTTKPEKLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000889  Glutathione_peroxidase  
IPR029760  GPX_CS  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0004602  F:glutathione peroxidase activity  
GO:0006979  P:response to oxidative stress  
Pfam View protein in Pfam  
PF00255  GSHPx  
PROSITE View protein in PROSITE  
PS00763  GLUTATHIONE_PEROXID_2  
PS51355  GLUTATHIONE_PEROXID_3  
CDD cd00340  GSH_Peroxidase  
Amino Acid Sequences MVVTRAASSFYDFAPLDKRGQAFPLDATRNKVVLVVNTASKCSFTPQYEGFEQLYQRLQKKYGDDFIILGFPCNQFMQQEPDSDDSIQSFCQLNYGVTFPVLAKIDVNGSTANPLYKWLKQQKTGILGMKRISWNFTKFSIDRTGKVRRRWSPTTKPEKLENHLISLLEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.25
5 0.27
6 0.23
7 0.25
8 0.25
9 0.22
10 0.23
11 0.28
12 0.3
13 0.31
14 0.35
15 0.35
16 0.34
17 0.32
18 0.31
19 0.24
20 0.2
21 0.23
22 0.19
23 0.21
24 0.21
25 0.22
26 0.2
27 0.2
28 0.19
29 0.18
30 0.22
31 0.19
32 0.23
33 0.24
34 0.29
35 0.29
36 0.31
37 0.29
38 0.26
39 0.24
40 0.21
41 0.23
42 0.23
43 0.26
44 0.25
45 0.26
46 0.27
47 0.31
48 0.33
49 0.33
50 0.3
51 0.27
52 0.25
53 0.23
54 0.23
55 0.18
56 0.15
57 0.11
58 0.09
59 0.1
60 0.1
61 0.09
62 0.07
63 0.09
64 0.14
65 0.14
66 0.15
67 0.16
68 0.18
69 0.19
70 0.19
71 0.17
72 0.12
73 0.11
74 0.1
75 0.1
76 0.08
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.08
84 0.07
85 0.07
86 0.06
87 0.09
88 0.09
89 0.08
90 0.07
91 0.08
92 0.09
93 0.09
94 0.1
95 0.08
96 0.07
97 0.09
98 0.09
99 0.09
100 0.08
101 0.11
102 0.13
103 0.16
104 0.25
105 0.33
106 0.38
107 0.43
108 0.48
109 0.5
110 0.52
111 0.54
112 0.52
113 0.45
114 0.42
115 0.38
116 0.39
117 0.36
118 0.32
119 0.31
120 0.29
121 0.29
122 0.29
123 0.3
124 0.32
125 0.29
126 0.33
127 0.39
128 0.37
129 0.37
130 0.4
131 0.49
132 0.5
133 0.58
134 0.64
135 0.62
136 0.68
137 0.74
138 0.78
139 0.78
140 0.82
141 0.84
142 0.82
143 0.78
144 0.78
145 0.77
146 0.73
147 0.73
148 0.64
149 0.58
150 0.52
151 0.47