Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8EQ52

Protein Details
Accession A0A1B8EQ52    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-68STEENQKPRFRRPFRRQRESRACNACRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 6, cyto 6
Family & Domain DBs
Amino Acid Sequences MRPQEPAVVAEILVPTLRSTDAPSAVPSAAPVAVPAAVRSPSTEENQKPRFRRPFRRQRESRACNACRTRKTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.08
5 0.07
6 0.1
7 0.12
8 0.14
9 0.14
10 0.15
11 0.16
12 0.15
13 0.15
14 0.12
15 0.1
16 0.08
17 0.07
18 0.06
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.1
28 0.12
29 0.15
30 0.21
31 0.24
32 0.33
33 0.4
34 0.47
35 0.47
36 0.55
37 0.63
38 0.66
39 0.73
40 0.75
41 0.79
42 0.83
43 0.9
44 0.88
45 0.89
46 0.91
47 0.86
48 0.85
49 0.84
50 0.77
51 0.75
52 0.78
53 0.76
54 0.74