Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CLR9

Protein Details
Accession A0A1B8CLR9   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-107NRTEKEPSRKKSTQKKTEKQQAAHNKSTEKKPAQKKPKTKHydrophilic
NLS Segment(s)
PositionSequence
73-107EPSRKKSTQKKTEKQQAAHNKSTEKKPAQKKPKTK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPSQKQNDGKSGSNVPYTAGTSTAFSLATLGNASVGPTYDPLAQWAGNTSTRDNPRSDFLFGIVLVENRTEKEPSRKKSTQKKTEKQQAAHNKSTEKKPAQKKPKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.28
4 0.26
5 0.21
6 0.16
7 0.14
8 0.13
9 0.13
10 0.12
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.06
25 0.07
26 0.08
27 0.08
28 0.09
29 0.1
30 0.1
31 0.09
32 0.1
33 0.11
34 0.13
35 0.14
36 0.14
37 0.19
38 0.22
39 0.24
40 0.24
41 0.23
42 0.23
43 0.24
44 0.24
45 0.18
46 0.16
47 0.15
48 0.13
49 0.13
50 0.1
51 0.08
52 0.07
53 0.08
54 0.08
55 0.08
56 0.1
57 0.1
58 0.13
59 0.23
60 0.32
61 0.38
62 0.47
63 0.52
64 0.6
65 0.7
66 0.78
67 0.79
68 0.81
69 0.84
70 0.86
71 0.9
72 0.89
73 0.82
74 0.81
75 0.82
76 0.79
77 0.76
78 0.69
79 0.66
80 0.64
81 0.67
82 0.67
83 0.64
84 0.66
85 0.69
86 0.76
87 0.81