Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CIQ8

Protein Details
Accession A0A1B8CIQ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-35AAPPPKPAKPIKPVKRAKPRLGFLHydrophilic
NLS Segment(s)
PositionSequence
14-31PPPKPAKPIKPVKRAKPR
Subcellular Location(s) mito 11, plas 6, cyto 4.5, E.R. 4, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVVPKLEPGSLAAPPPKPAKPIKPVKRAKPRLGFLEKLQRLEKTLGLYSPVCIKLFEYVLFGSLMSIMALMVVSFLLFSMGVAVYLFVEGMKMAVVWLRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.29
4 0.32
5 0.37
6 0.42
7 0.47
8 0.57
9 0.63
10 0.69
11 0.76
12 0.81
13 0.86
14 0.87
15 0.86
16 0.84
17 0.79
18 0.77
19 0.74
20 0.66
21 0.59
22 0.61
23 0.53
24 0.48
25 0.45
26 0.36
27 0.33
28 0.32
29 0.28
30 0.2
31 0.19
32 0.15
33 0.16
34 0.16
35 0.14
36 0.15
37 0.15
38 0.13
39 0.12
40 0.12
41 0.11
42 0.12
43 0.12
44 0.1
45 0.09
46 0.09
47 0.09
48 0.09
49 0.07
50 0.06
51 0.06
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.04
81 0.06