Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C0W9

Protein Details
Accession A0A1B8C0W9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVDKKRKLGEQFRKRRNNLFQRVHETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MVDKKRKLGEQFRKRRNNLFQRVHETSAVCEANILIVVEKNNRLHIYGTMDEPAKLLCKEYKAKKEITVKRPEELKTTSRMEKAACRRNNASNPPPTPPSSPPIGIPAAPKLDLDPHRGLASLKGSFVDFVTNIRLSNDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.86
5 0.85
6 0.84
7 0.81
8 0.79
9 0.79
10 0.72
11 0.64
12 0.53
13 0.44
14 0.41
15 0.33
16 0.24
17 0.19
18 0.16
19 0.13
20 0.13
21 0.12
22 0.05
23 0.06
24 0.08
25 0.1
26 0.14
27 0.15
28 0.17
29 0.17
30 0.18
31 0.18
32 0.19
33 0.22
34 0.19
35 0.19
36 0.19
37 0.18
38 0.17
39 0.16
40 0.15
41 0.11
42 0.1
43 0.11
44 0.1
45 0.14
46 0.22
47 0.29
48 0.37
49 0.38
50 0.4
51 0.45
52 0.54
53 0.58
54 0.59
55 0.62
56 0.55
57 0.55
58 0.57
59 0.52
60 0.46
61 0.4
62 0.34
63 0.29
64 0.32
65 0.32
66 0.29
67 0.29
68 0.26
69 0.3
70 0.37
71 0.41
72 0.41
73 0.43
74 0.46
75 0.52
76 0.59
77 0.59
78 0.57
79 0.55
80 0.54
81 0.53
82 0.53
83 0.48
84 0.45
85 0.39
86 0.36
87 0.32
88 0.3
89 0.27
90 0.28
91 0.26
92 0.23
93 0.22
94 0.22
95 0.2
96 0.2
97 0.19
98 0.16
99 0.22
100 0.24
101 0.28
102 0.28
103 0.27
104 0.27
105 0.28
106 0.28
107 0.24
108 0.27
109 0.21
110 0.19
111 0.18
112 0.18
113 0.18
114 0.18
115 0.17
116 0.11
117 0.12
118 0.17
119 0.17
120 0.17