Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CDN0

Protein Details
Accession A0A1B8CDN0   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-111ITKARGKGPPKKKRTAAESKKFKGKKKVTEEBasic
NLS Segment(s)
PositionSequence
83-107KARGKGPPKKKRTAAESKKFKGKKK
Subcellular Location(s) mito 14, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVARSRVVDLMKTQCKIFSTTFNPEGVRTGNKILRQRLKGPALAAYYPRKVVTINDLRKAYPELVTWNEKEEDRLESVAITKARGKGPPKKKRTAAESKKFKGKKKVTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.36
5 0.33
6 0.31
7 0.31
8 0.37
9 0.39
10 0.38
11 0.37
12 0.34
13 0.34
14 0.29
15 0.25
16 0.2
17 0.23
18 0.24
19 0.29
20 0.35
21 0.41
22 0.46
23 0.48
24 0.51
25 0.53
26 0.53
27 0.49
28 0.44
29 0.39
30 0.33
31 0.3
32 0.29
33 0.24
34 0.22
35 0.21
36 0.21
37 0.17
38 0.15
39 0.15
40 0.2
41 0.26
42 0.28
43 0.32
44 0.33
45 0.32
46 0.33
47 0.34
48 0.27
49 0.18
50 0.16
51 0.14
52 0.17
53 0.2
54 0.19
55 0.2
56 0.2
57 0.19
58 0.2
59 0.18
60 0.17
61 0.15
62 0.16
63 0.13
64 0.12
65 0.13
66 0.16
67 0.15
68 0.14
69 0.16
70 0.19
71 0.22
72 0.28
73 0.33
74 0.4
75 0.5
76 0.6
77 0.65
78 0.71
79 0.76
80 0.78
81 0.81
82 0.82
83 0.82
84 0.82
85 0.84
86 0.82
87 0.84
88 0.83
89 0.82
90 0.82
91 0.8
92 0.8