Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C7P7

Protein Details
Accession A0A1B8C7P7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-38LPVMGYQKYRKHKARKTLKKELASQPEHydrophilic
NLS Segment(s)
PositionSequence
21-29RKHKARKTL
Subcellular Location(s) extr 17, mito 6, plas 2
Family & Domain DBs
Amino Acid Sequences MAAVVLMAIVVLPVMGYQKYRKHKARKTLKKELASQPEQIQGGHQAVREQSGDHPPSYDDTVGSHPSPPYSSNRPPGYVQRTSGNRGLPVGHLPGSYLSPTAVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.08
4 0.13
5 0.22
6 0.31
7 0.41
8 0.5
9 0.6
10 0.67
11 0.76
12 0.83
13 0.85
14 0.86
15 0.88
16 0.87
17 0.82
18 0.82
19 0.8
20 0.78
21 0.69
22 0.63
23 0.53
24 0.48
25 0.43
26 0.35
27 0.26
28 0.19
29 0.18
30 0.16
31 0.14
32 0.11
33 0.11
34 0.13
35 0.12
36 0.1
37 0.11
38 0.17
39 0.18
40 0.16
41 0.17
42 0.16
43 0.17
44 0.18
45 0.16
46 0.09
47 0.1
48 0.12
49 0.14
50 0.15
51 0.14
52 0.13
53 0.14
54 0.15
55 0.15
56 0.19
57 0.24
58 0.3
59 0.37
60 0.39
61 0.41
62 0.43
63 0.49
64 0.51
65 0.47
66 0.43
67 0.43
68 0.45
69 0.47
70 0.48
71 0.42
72 0.35
73 0.32
74 0.31
75 0.25
76 0.24
77 0.22
78 0.19
79 0.17
80 0.16
81 0.17
82 0.18
83 0.17
84 0.14
85 0.11