Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZHH6

Protein Details
Accession C7ZHH6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPPKKLVPAKKRKRPEPETASKEDEBasic
NLS Segment(s)
PositionSequence
4-15KKLVPAKKRKRP
Subcellular Location(s) mito_nucl 10.666, nucl 10.5, mito 9.5, cyto_mito 8.833, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
KEGG nhe:NECHADRAFT_81246  -  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MPPKKLVPAKKRKRPEPETASKEDETPFMREIIPDGDVILIVGPEKSKIQVSSHLLRTTSPVFNVMLGPNFKEGAALRENEGPTEIVLPEDNAKALWNVYSTLYGANPHVNKLKPDEIYDVAVLAQKYDLIDRLELACESWFAHTGAITYGSTKKDWKMLLAAYWLRSELGFKNTSIMLIEADQEPLYRFGMGTSDQVLGLRLCLAIYELRVAGFEDFGLCLSCFESPETEEFSEGNPKCTSKYRESVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.88
5 0.85
6 0.8
7 0.77
8 0.67
9 0.61
10 0.51
11 0.45
12 0.37
13 0.33
14 0.27
15 0.22
16 0.22
17 0.19
18 0.2
19 0.18
20 0.16
21 0.13
22 0.12
23 0.1
24 0.1
25 0.09
26 0.07
27 0.05
28 0.04
29 0.05
30 0.05
31 0.06
32 0.07
33 0.09
34 0.11
35 0.13
36 0.15
37 0.22
38 0.29
39 0.35
40 0.39
41 0.4
42 0.38
43 0.37
44 0.38
45 0.35
46 0.31
47 0.24
48 0.2
49 0.18
50 0.18
51 0.2
52 0.17
53 0.16
54 0.15
55 0.16
56 0.15
57 0.15
58 0.14
59 0.14
60 0.13
61 0.13
62 0.15
63 0.15
64 0.15
65 0.19
66 0.2
67 0.18
68 0.19
69 0.15
70 0.12
71 0.13
72 0.11
73 0.07
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.12
94 0.12
95 0.14
96 0.18
97 0.18
98 0.19
99 0.23
100 0.26
101 0.22
102 0.24
103 0.25
104 0.22
105 0.22
106 0.21
107 0.16
108 0.12
109 0.13
110 0.11
111 0.08
112 0.07
113 0.05
114 0.06
115 0.06
116 0.07
117 0.06
118 0.06
119 0.07
120 0.08
121 0.08
122 0.08
123 0.08
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.08
135 0.07
136 0.08
137 0.11
138 0.12
139 0.13
140 0.15
141 0.15
142 0.19
143 0.19
144 0.19
145 0.19
146 0.18
147 0.18
148 0.22
149 0.22
150 0.19
151 0.19
152 0.18
153 0.15
154 0.14
155 0.15
156 0.12
157 0.15
158 0.15
159 0.15
160 0.16
161 0.16
162 0.16
163 0.15
164 0.13
165 0.09
166 0.08
167 0.1
168 0.08
169 0.09
170 0.09
171 0.09
172 0.09
173 0.1
174 0.1
175 0.09
176 0.08
177 0.07
178 0.1
179 0.1
180 0.11
181 0.11
182 0.12
183 0.11
184 0.12
185 0.13
186 0.11
187 0.1
188 0.09
189 0.07
190 0.06
191 0.06
192 0.07
193 0.07
194 0.08
195 0.09
196 0.09
197 0.09
198 0.09
199 0.1
200 0.09
201 0.09
202 0.08
203 0.07
204 0.07
205 0.07
206 0.09
207 0.08
208 0.08
209 0.09
210 0.09
211 0.1
212 0.11
213 0.12
214 0.13
215 0.15
216 0.2
217 0.2
218 0.2
219 0.19
220 0.2
221 0.28
222 0.27
223 0.29
224 0.26
225 0.26
226 0.29
227 0.38
228 0.43
229 0.41
230 0.48