Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8C0I2

Protein Details
Accession A0A1B8C0I2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MVDFKKLFNRKNPKTVRPKRPEYEDKNVQPCHydrophilic
77-97LFEFAPRKYRRERTNKKEILEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 11.833, mito_nucl 11.833, mito 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVDFKKLFNRKNPKTVRPKRPEYEDKNVQPCLPKTRNRSLSLYEPGQHTSGLLRKLPIELRRRIYDEVLGHRKVHLLFEFAPRKYRRERTNKKEILEWRWWHCICTWDQTKDDYLASIWFDRCKDQAVNGNTGPPNGMMGKLKLDFAILLTCRQIYSEAIDILYSTTTFDFGSRQLLWDFPSLVLPQRFALISAIEMLWEFIDLGLSPIDTERTQLYQDMWAMLAAMPNLRHLKIGVAAHECPDPAPPDLKEVWLGPPKQLGNLDVFVVLVPVSYARIFNFGVDEGSNFTLDSFPDIVTMYCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.9
4 0.89
5 0.9
6 0.88
7 0.88
8 0.89
9 0.86
10 0.85
11 0.84
12 0.83
13 0.79
14 0.73
15 0.66
16 0.63
17 0.59
18 0.58
19 0.56
20 0.56
21 0.57
22 0.66
23 0.71
24 0.69
25 0.69
26 0.64
27 0.64
28 0.63
29 0.58
30 0.51
31 0.45
32 0.42
33 0.38
34 0.32
35 0.25
36 0.22
37 0.23
38 0.23
39 0.23
40 0.22
41 0.22
42 0.26
43 0.31
44 0.35
45 0.38
46 0.42
47 0.46
48 0.5
49 0.53
50 0.52
51 0.48
52 0.46
53 0.42
54 0.44
55 0.45
56 0.42
57 0.39
58 0.37
59 0.38
60 0.33
61 0.32
62 0.23
63 0.2
64 0.2
65 0.3
66 0.36
67 0.33
68 0.41
69 0.39
70 0.43
71 0.48
72 0.54
73 0.55
74 0.6
75 0.7
76 0.71
77 0.8
78 0.81
79 0.74
80 0.73
81 0.69
82 0.65
83 0.63
84 0.59
85 0.52
86 0.55
87 0.54
88 0.47
89 0.42
90 0.39
91 0.31
92 0.36
93 0.37
94 0.31
95 0.32
96 0.33
97 0.33
98 0.3
99 0.28
100 0.19
101 0.14
102 0.12
103 0.12
104 0.12
105 0.12
106 0.12
107 0.13
108 0.14
109 0.14
110 0.16
111 0.15
112 0.16
113 0.23
114 0.24
115 0.27
116 0.26
117 0.3
118 0.27
119 0.26
120 0.24
121 0.16
122 0.14
123 0.1
124 0.11
125 0.08
126 0.08
127 0.1
128 0.1
129 0.11
130 0.09
131 0.09
132 0.08
133 0.07
134 0.1
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.09
142 0.06
143 0.08
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.08
150 0.07
151 0.05
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.1
160 0.09
161 0.11
162 0.1
163 0.11
164 0.12
165 0.13
166 0.13
167 0.1
168 0.11
169 0.11
170 0.15
171 0.14
172 0.14
173 0.13
174 0.13
175 0.12
176 0.11
177 0.12
178 0.08
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.05
185 0.05
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.07
197 0.07
198 0.08
199 0.09
200 0.1
201 0.11
202 0.12
203 0.13
204 0.13
205 0.14
206 0.13
207 0.12
208 0.1
209 0.1
210 0.09
211 0.09
212 0.07
213 0.08
214 0.08
215 0.12
216 0.15
217 0.14
218 0.14
219 0.14
220 0.15
221 0.19
222 0.2
223 0.2
224 0.21
225 0.22
226 0.23
227 0.23
228 0.22
229 0.17
230 0.18
231 0.16
232 0.14
233 0.18
234 0.17
235 0.21
236 0.21
237 0.22
238 0.22
239 0.21
240 0.26
241 0.29
242 0.29
243 0.26
244 0.32
245 0.31
246 0.33
247 0.33
248 0.27
249 0.25
250 0.25
251 0.24
252 0.17
253 0.17
254 0.13
255 0.12
256 0.1
257 0.06
258 0.05
259 0.04
260 0.06
261 0.07
262 0.08
263 0.08
264 0.12
265 0.12
266 0.13
267 0.15
268 0.13
269 0.15
270 0.14
271 0.14
272 0.14
273 0.15
274 0.15
275 0.13
276 0.13
277 0.12
278 0.12
279 0.15
280 0.13
281 0.12
282 0.12
283 0.13