Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8BYE9

Protein Details
Accession A0A1B8BYE9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-113PDIKLRDAPPKKKRRKAPSRPPLLPSBasic
NLS Segment(s)
PositionSequence
92-108LRDAPPKKKRRKAPSRP
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MESASAPQRQTLERRRFHLFKKCEQMRRVCGIKVALYTWDPKSEKQMNFHSHRLSNAEKSRLIESDSSITMYPEGFETDEKSAMKAVPDIKLRDAPPKKKRRKAPSRPPLLPSAAPQLLPVEDPRLIPLPPSPPSIPTQSVEGPQPVSLSLSPVLMPTQDMDNHQLIPLPPVPLWMIPPAEFNHTHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.67
4 0.7
5 0.71
6 0.67
7 0.67
8 0.71
9 0.76
10 0.76
11 0.77
12 0.78
13 0.74
14 0.75
15 0.7
16 0.6
17 0.54
18 0.48
19 0.43
20 0.35
21 0.29
22 0.23
23 0.21
24 0.24
25 0.22
26 0.27
27 0.26
28 0.25
29 0.33
30 0.39
31 0.41
32 0.43
33 0.5
34 0.51
35 0.55
36 0.59
37 0.56
38 0.48
39 0.47
40 0.46
41 0.4
42 0.4
43 0.4
44 0.39
45 0.36
46 0.36
47 0.36
48 0.32
49 0.3
50 0.23
51 0.19
52 0.18
53 0.16
54 0.15
55 0.14
56 0.13
57 0.11
58 0.1
59 0.09
60 0.06
61 0.07
62 0.06
63 0.06
64 0.08
65 0.09
66 0.12
67 0.11
68 0.11
69 0.11
70 0.11
71 0.11
72 0.12
73 0.12
74 0.14
75 0.18
76 0.19
77 0.19
78 0.23
79 0.23
80 0.31
81 0.36
82 0.41
83 0.48
84 0.58
85 0.67
86 0.71
87 0.8
88 0.81
89 0.85
90 0.87
91 0.88
92 0.88
93 0.87
94 0.83
95 0.76
96 0.69
97 0.61
98 0.5
99 0.41
100 0.37
101 0.28
102 0.24
103 0.21
104 0.18
105 0.15
106 0.15
107 0.14
108 0.1
109 0.1
110 0.1
111 0.12
112 0.13
113 0.12
114 0.12
115 0.14
116 0.17
117 0.18
118 0.23
119 0.22
120 0.22
121 0.25
122 0.29
123 0.29
124 0.25
125 0.27
126 0.24
127 0.25
128 0.25
129 0.24
130 0.2
131 0.18
132 0.17
133 0.13
134 0.14
135 0.12
136 0.12
137 0.11
138 0.11
139 0.11
140 0.11
141 0.11
142 0.09
143 0.1
144 0.08
145 0.11
146 0.12
147 0.14
148 0.18
149 0.19
150 0.2
151 0.19
152 0.21
153 0.18
154 0.21
155 0.21
156 0.19
157 0.17
158 0.19
159 0.2
160 0.18
161 0.2
162 0.2
163 0.2
164 0.18
165 0.21
166 0.22
167 0.25