Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CDV8

Protein Details
Accession A0A1B8CDV8   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-93VATSSRPYDGRRRRRRHSSAGGRPVSRHydrophilic
NLS Segment(s)
PositionSequence
77-86RRRRRRHSSA
Subcellular Location(s) plas 12, extr 6, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYIPIANLEVRQASADAAAASPQPNCMSGGSIAGIVIGCIAGTLFFVWLWSALRRNTTDEGYKHGAVATSSRPYDGRRRRRRHSSAGGRPVSRSYSTYETTERPARVVYRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.07
5 0.08
6 0.08
7 0.09
8 0.08
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.12
15 0.11
16 0.12
17 0.1
18 0.1
19 0.09
20 0.08
21 0.07
22 0.05
23 0.04
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.06
38 0.09
39 0.1
40 0.12
41 0.14
42 0.17
43 0.18
44 0.19
45 0.23
46 0.2
47 0.25
48 0.26
49 0.25
50 0.22
51 0.21
52 0.19
53 0.15
54 0.16
55 0.13
56 0.13
57 0.13
58 0.14
59 0.15
60 0.18
61 0.28
62 0.37
63 0.45
64 0.53
65 0.62
66 0.7
67 0.8
68 0.85
69 0.85
70 0.85
71 0.85
72 0.85
73 0.86
74 0.83
75 0.73
76 0.66
77 0.59
78 0.52
79 0.43
80 0.34
81 0.29
82 0.29
83 0.3
84 0.32
85 0.33
86 0.32
87 0.36
88 0.41
89 0.37
90 0.33
91 0.34