Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8CG70

Protein Details
Accession A0A1B8CG70    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
168-190KPLSVARKPQKKKKPVIAPKTAEHydrophilic
NLS Segment(s)
PositionSequence
173-182ARKPQKKKKP
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018800  PRCC  
Pfam View protein in Pfam  
PF10253  PRCC  
Amino Acid Sequences MGLVDYSDSESSDNEQVSETKKPTKGSFQKVVDRSNPGKIKVTLPTTTAPTNDEPPAKRAKTSGGTFGGFNSFLPAPKKTGTAAPKTLGGGATGNGRGGGLGSGVSLKTGAAPAFSRNPEPVYNGGDNYDGREGSKGGESSMGLPPPNSAAQIPAADVKLVGKPLMFKPLSVARKPQKKKKPVIAPKTAEDTTSQGPSDTASEAPKAPPAKVSLFSVPQDTDDDVAPERKGEYQPMLYGAKPEEEEEPEVVKNPYYEDQYNDAESHHTVPPPAARAAPPASTTSNSLDNIASDLQLSASERRQLFGRQGARNLTASKVINFNTDEEYRNNEELRSAGEQAVHNPVRSIAPGKHSLKQLLNATVSQKEALEESFAKGYANRKEASGRYGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.22
5 0.29
6 0.29
7 0.33
8 0.37
9 0.42
10 0.45
11 0.53
12 0.59
13 0.62
14 0.67
15 0.66
16 0.72
17 0.73
18 0.76
19 0.7
20 0.69
21 0.63
22 0.63
23 0.6
24 0.54
25 0.55
26 0.5
27 0.49
28 0.48
29 0.5
30 0.42
31 0.39
32 0.39
33 0.37
34 0.36
35 0.33
36 0.29
37 0.27
38 0.29
39 0.31
40 0.35
41 0.33
42 0.35
43 0.44
44 0.41
45 0.4
46 0.37
47 0.4
48 0.41
49 0.42
50 0.45
51 0.39
52 0.38
53 0.37
54 0.36
55 0.32
56 0.24
57 0.21
58 0.18
59 0.14
60 0.16
61 0.19
62 0.2
63 0.2
64 0.22
65 0.23
66 0.21
67 0.28
68 0.32
69 0.36
70 0.38
71 0.37
72 0.37
73 0.36
74 0.36
75 0.28
76 0.22
77 0.16
78 0.12
79 0.14
80 0.12
81 0.11
82 0.1
83 0.1
84 0.08
85 0.08
86 0.07
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.07
97 0.06
98 0.07
99 0.08
100 0.11
101 0.17
102 0.18
103 0.2
104 0.2
105 0.22
106 0.22
107 0.24
108 0.23
109 0.23
110 0.23
111 0.22
112 0.21
113 0.2
114 0.19
115 0.19
116 0.18
117 0.12
118 0.12
119 0.12
120 0.11
121 0.11
122 0.14
123 0.11
124 0.1
125 0.11
126 0.11
127 0.13
128 0.15
129 0.15
130 0.13
131 0.12
132 0.12
133 0.13
134 0.14
135 0.11
136 0.09
137 0.09
138 0.1
139 0.1
140 0.11
141 0.1
142 0.1
143 0.09
144 0.09
145 0.09
146 0.08
147 0.09
148 0.08
149 0.07
150 0.09
151 0.1
152 0.18
153 0.17
154 0.16
155 0.19
156 0.27
157 0.32
158 0.31
159 0.38
160 0.38
161 0.48
162 0.55
163 0.62
164 0.64
165 0.69
166 0.76
167 0.77
168 0.81
169 0.81
170 0.83
171 0.82
172 0.75
173 0.68
174 0.65
175 0.56
176 0.45
177 0.35
178 0.29
179 0.21
180 0.19
181 0.16
182 0.11
183 0.11
184 0.11
185 0.11
186 0.09
187 0.08
188 0.08
189 0.09
190 0.1
191 0.1
192 0.13
193 0.13
194 0.13
195 0.13
196 0.16
197 0.17
198 0.17
199 0.19
200 0.18
201 0.19
202 0.2
203 0.2
204 0.17
205 0.16
206 0.16
207 0.14
208 0.12
209 0.1
210 0.11
211 0.1
212 0.11
213 0.1
214 0.09
215 0.09
216 0.11
217 0.12
218 0.13
219 0.15
220 0.14
221 0.15
222 0.18
223 0.19
224 0.16
225 0.17
226 0.15
227 0.14
228 0.13
229 0.14
230 0.12
231 0.13
232 0.15
233 0.14
234 0.15
235 0.14
236 0.15
237 0.15
238 0.13
239 0.11
240 0.12
241 0.14
242 0.16
243 0.17
244 0.18
245 0.22
246 0.23
247 0.25
248 0.22
249 0.2
250 0.18
251 0.18
252 0.18
253 0.16
254 0.15
255 0.14
256 0.15
257 0.17
258 0.18
259 0.18
260 0.16
261 0.15
262 0.19
263 0.21
264 0.21
265 0.2
266 0.2
267 0.21
268 0.2
269 0.22
270 0.21
271 0.22
272 0.21
273 0.21
274 0.18
275 0.16
276 0.17
277 0.15
278 0.13
279 0.09
280 0.08
281 0.07
282 0.08
283 0.1
284 0.11
285 0.13
286 0.19
287 0.19
288 0.2
289 0.22
290 0.24
291 0.27
292 0.33
293 0.39
294 0.37
295 0.41
296 0.44
297 0.44
298 0.44
299 0.4
300 0.34
301 0.31
302 0.28
303 0.26
304 0.26
305 0.24
306 0.26
307 0.26
308 0.26
309 0.25
310 0.26
311 0.27
312 0.24
313 0.3
314 0.31
315 0.32
316 0.32
317 0.27
318 0.25
319 0.23
320 0.25
321 0.22
322 0.19
323 0.18
324 0.21
325 0.21
326 0.23
327 0.32
328 0.29
329 0.26
330 0.25
331 0.25
332 0.23
333 0.24
334 0.26
335 0.21
336 0.25
337 0.34
338 0.38
339 0.42
340 0.46
341 0.5
342 0.49
343 0.52
344 0.52
345 0.48
346 0.47
347 0.43
348 0.42
349 0.38
350 0.36
351 0.3
352 0.24
353 0.2
354 0.18
355 0.16
356 0.18
357 0.17
358 0.18
359 0.19
360 0.19
361 0.18
362 0.2
363 0.27
364 0.3
365 0.34
366 0.32
367 0.33
368 0.4
369 0.42