Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CR69

Protein Details
Accession A0A1B8CR69    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-35ARLPPLPKLRVKRPNQNNSNPCHydrophilic
NLS Segment(s)
PositionSequence
96-98KRK
Subcellular Location(s) mito 24.5, mito_nucl 13.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKKVAVPKAVTARLPPLPKLRVKRPNQNNSNPCLGIMTSVLTCWASSGYSVAGCSALETSLRACMDKPRPKDVKKNTINYHLSRMYPQIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.41
4 0.39
5 0.38
6 0.4
7 0.47
8 0.52
9 0.57
10 0.61
11 0.66
12 0.72
13 0.75
14 0.8
15 0.82
16 0.85
17 0.8
18 0.74
19 0.71
20 0.6
21 0.49
22 0.39
23 0.3
24 0.2
25 0.15
26 0.12
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.08
50 0.09
51 0.09
52 0.09
53 0.17
54 0.27
55 0.35
56 0.39
57 0.46
58 0.55
59 0.6
60 0.7
61 0.73
62 0.73
63 0.74
64 0.79
65 0.75
66 0.76
67 0.77
68 0.7
69 0.67
70 0.6
71 0.52
72 0.45
73 0.43
74 0.36
75 0.3
76 0.29
77 0.31
78 0.37