Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8BX55

Protein Details
Accession A0A1B8BX55   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-113NPNRQRKIPVACTRCRKRKIKCGGPQVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR000433  Znf_ZZ  
IPR043145  Znf_ZZ_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50135  ZF_ZZ_2  
Amino Acid Sequences MSCIFTCDACHEEILAEKPCIHCQICPSYSLCANCYVCEKCTGDHVLSHTTILFEMSGYLGRPPPMPPRPPLPQSPAAAPKRRLVLNPNRQRKIPVACTRCRKRKIKCGGPQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.19
5 0.21
6 0.23
7 0.27
8 0.25
9 0.22
10 0.24
11 0.32
12 0.31
13 0.31
14 0.29
15 0.28
16 0.31
17 0.31
18 0.27
19 0.25
20 0.25
21 0.23
22 0.26
23 0.25
24 0.22
25 0.25
26 0.24
27 0.18
28 0.21
29 0.23
30 0.19
31 0.19
32 0.2
33 0.18
34 0.18
35 0.18
36 0.14
37 0.11
38 0.1
39 0.09
40 0.07
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.07
50 0.09
51 0.17
52 0.23
53 0.26
54 0.28
55 0.33
56 0.39
57 0.42
58 0.44
59 0.42
60 0.42
61 0.41
62 0.43
63 0.47
64 0.47
65 0.51
66 0.49
67 0.46
68 0.45
69 0.45
70 0.43
71 0.42
72 0.47
73 0.51
74 0.59
75 0.66
76 0.65
77 0.64
78 0.65
79 0.63
80 0.6
81 0.6
82 0.6
83 0.57
84 0.63
85 0.72
86 0.79
87 0.83
88 0.84
89 0.83
90 0.83
91 0.86
92 0.88
93 0.88