Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CJS3

Protein Details
Accession A0A1B8CJS3    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPDNNRQAKKEKKKEKNRARKEKDEKKWEAMKABasic
NLS Segment(s)
PositionSequence
8-56AKKEKKKEKNRARKEKDEKKWEAMKAKARKEVEEENEEKERKKKLAKAG
85-93AKKKIKEKK
112-124EEKKKRAAPKGPL
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MPDNNRQAKKEKKKEKNRARKEKDEKKWEAMKAKARKEVEEENEEKERKKKLAKAGLKELTHAQQLRKEELLAQNDGFAALFRAAKKKIKEKKEVVAAIAVALEEAEEGQKEEKKKRAAPKGPLTHGQLIRKEELLKQKRGFTEQFRVVKKEIREKKEVVATIPEALEEAEKGQKEAEKEKKELDRQYAEVVTKLKLLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.96
4 0.96
5 0.96
6 0.94
7 0.95
8 0.94
9 0.94
10 0.93
11 0.92
12 0.87
13 0.85
14 0.83
15 0.79
16 0.76
17 0.73
18 0.72
19 0.7
20 0.71
21 0.7
22 0.64
23 0.6
24 0.57
25 0.58
26 0.54
27 0.53
28 0.48
29 0.45
30 0.5
31 0.49
32 0.46
33 0.43
34 0.42
35 0.4
36 0.45
37 0.47
38 0.5
39 0.59
40 0.64
41 0.66
42 0.7
43 0.72
44 0.65
45 0.6
46 0.53
47 0.44
48 0.42
49 0.37
50 0.29
51 0.26
52 0.28
53 0.29
54 0.27
55 0.25
56 0.24
57 0.27
58 0.28
59 0.25
60 0.23
61 0.2
62 0.19
63 0.19
64 0.14
65 0.09
66 0.06
67 0.05
68 0.07
69 0.07
70 0.12
71 0.14
72 0.2
73 0.24
74 0.33
75 0.41
76 0.48
77 0.56
78 0.57
79 0.61
80 0.64
81 0.6
82 0.51
83 0.43
84 0.35
85 0.25
86 0.2
87 0.14
88 0.05
89 0.04
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.05
97 0.08
98 0.11
99 0.16
100 0.22
101 0.28
102 0.34
103 0.43
104 0.52
105 0.57
106 0.63
107 0.69
108 0.7
109 0.69
110 0.67
111 0.62
112 0.59
113 0.55
114 0.51
115 0.45
116 0.4
117 0.38
118 0.35
119 0.32
120 0.29
121 0.36
122 0.38
123 0.42
124 0.42
125 0.46
126 0.46
127 0.5
128 0.5
129 0.46
130 0.48
131 0.49
132 0.53
133 0.51
134 0.52
135 0.49
136 0.5
137 0.49
138 0.51
139 0.52
140 0.51
141 0.54
142 0.52
143 0.56
144 0.57
145 0.53
146 0.44
147 0.39
148 0.34
149 0.3
150 0.28
151 0.22
152 0.16
153 0.15
154 0.13
155 0.08
156 0.09
157 0.12
158 0.12
159 0.13
160 0.14
161 0.17
162 0.2
163 0.3
164 0.38
165 0.39
166 0.42
167 0.5
168 0.57
169 0.62
170 0.66
171 0.64
172 0.6
173 0.56
174 0.59
175 0.55
176 0.48
177 0.44
178 0.38
179 0.31
180 0.27