Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8C2S1

Protein Details
Accession A0A1B8C2S1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
61-80NKASAPKKPIFRRTPRAPTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MGWLWSSAAAPADAAAPTPQPQTTSTKQAPPPATTPSQPLTPAQLAEQDLQAALAEFDAENKASAPKKPIFRRTPRAPTEGAPSSATPETELNVEDSLYPTTMSCRDAFDAAFYCQSLGGQFNAVYRYGGMQSCSDHWKSFWFCMRSKSYAGQREDMIKEHYRKKALKYKVGPSSEDVWEGREKKMEWGEAFSEGVEELLPGESDEEWNVRERKRREGRNGGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.11
5 0.14
6 0.14
7 0.15
8 0.18
9 0.24
10 0.28
11 0.36
12 0.38
13 0.44
14 0.47
15 0.54
16 0.55
17 0.52
18 0.5
19 0.47
20 0.47
21 0.4
22 0.41
23 0.35
24 0.34
25 0.31
26 0.29
27 0.28
28 0.26
29 0.25
30 0.21
31 0.22
32 0.21
33 0.21
34 0.2
35 0.14
36 0.13
37 0.12
38 0.11
39 0.07
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.11
50 0.13
51 0.15
52 0.2
53 0.25
54 0.34
55 0.42
56 0.52
57 0.57
58 0.65
59 0.72
60 0.76
61 0.8
62 0.76
63 0.72
64 0.64
65 0.56
66 0.53
67 0.46
68 0.38
69 0.29
70 0.25
71 0.24
72 0.23
73 0.21
74 0.15
75 0.13
76 0.11
77 0.11
78 0.11
79 0.09
80 0.08
81 0.08
82 0.07
83 0.08
84 0.08
85 0.07
86 0.07
87 0.06
88 0.07
89 0.08
90 0.1
91 0.09
92 0.1
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.1
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.08
113 0.07
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.1
120 0.12
121 0.16
122 0.17
123 0.16
124 0.15
125 0.2
126 0.21
127 0.24
128 0.3
129 0.29
130 0.3
131 0.36
132 0.4
133 0.38
134 0.38
135 0.41
136 0.42
137 0.46
138 0.47
139 0.43
140 0.39
141 0.42
142 0.41
143 0.36
144 0.34
145 0.32
146 0.35
147 0.4
148 0.44
149 0.46
150 0.48
151 0.55
152 0.59
153 0.61
154 0.65
155 0.64
156 0.68
157 0.69
158 0.69
159 0.62
160 0.56
161 0.53
162 0.44
163 0.4
164 0.31
165 0.25
166 0.29
167 0.29
168 0.27
169 0.27
170 0.27
171 0.3
172 0.35
173 0.37
174 0.31
175 0.34
176 0.34
177 0.31
178 0.3
179 0.23
180 0.19
181 0.13
182 0.12
183 0.08
184 0.06
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.07
191 0.08
192 0.09
193 0.1
194 0.11
195 0.18
196 0.23
197 0.27
198 0.36
199 0.38
200 0.48
201 0.57
202 0.66
203 0.7
204 0.77