Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W426

Protein Details
Accession G0W426   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPEPPRKKSKKNQKQTRKNIKKKAPISPRSTLHydrophilic
NLS Segment(s)
PositionSequence
5-25PRKKSKKNQKQTRKNIKKKAP
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG ndi:NDAI_0A04070  -  
Pfam View protein in Pfam  
PF13893  RRM_5  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MPEPPRKKSKKNQKQTRKNIKKKAPISPRSTLYVSNLNEKINPKRLRINLYLLFSIYGEVIKVAISAKKQRGQAYITMKNVDEANLAKISLNDELFFENPLHIEFSKEDSIIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.97
4 0.96
5 0.96
6 0.95
7 0.94
8 0.93
9 0.89
10 0.88
11 0.87
12 0.84
13 0.81
14 0.77
15 0.69
16 0.64
17 0.58
18 0.49
19 0.41
20 0.4
21 0.34
22 0.34
23 0.33
24 0.29
25 0.3
26 0.33
27 0.35
28 0.37
29 0.39
30 0.35
31 0.41
32 0.44
33 0.47
34 0.46
35 0.48
36 0.42
37 0.41
38 0.38
39 0.31
40 0.27
41 0.21
42 0.18
43 0.11
44 0.07
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.04
51 0.06
52 0.08
53 0.14
54 0.19
55 0.24
56 0.28
57 0.31
58 0.33
59 0.34
60 0.38
61 0.41
62 0.43
63 0.4
64 0.38
65 0.35
66 0.34
67 0.32
68 0.25
69 0.18
70 0.13
71 0.14
72 0.12
73 0.13
74 0.11
75 0.12
76 0.13
77 0.14
78 0.14
79 0.11
80 0.12
81 0.14
82 0.14
83 0.15
84 0.14
85 0.11
86 0.11
87 0.12
88 0.14
89 0.12
90 0.15
91 0.15
92 0.2
93 0.22