Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CRD3

Protein Details
Accession A0A1B8CRD3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MVYKIKKRRRRSSSPESIDPKRRVPPRKRSRLGYNSRKRRSPSPDBasic
NLS Segment(s)
PositionSequence
5-41IKKRRRRSSSPESIDPKRRVPPRKRSRLGYNSRKRRS
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007438  DUF488  
Pfam View protein in Pfam  
PF04343  DUF488  
Amino Acid Sequences MVYKIKKRRRRSSSPESIDPKRRVPPRKRSRLGYNSRKRRSPSPDLTDSPHPRSEHSPAPPSNRSEIAQVSPVIKGEPDSPILEAFPELKIRSPVKSQLSLDSINPFESPDPDSPMPQSESSIKLDSDADLTPFHTPEVLCIGHSTLPFRGLVQLLKLMDVSHIVDVRSRPVSTVSPQFNFAKLTSSRHLMTSNIQYLWLGKSLGGRRENMDGVLRHTEMLVPDLKNYAAYMTTPAFKAGLAELKKLATEQAKKGKRIVLMCEEAVHWRCHRRMIADRLVADKYIVKHMGLRAKECVEHVMWNIARLALDNEVVYDVARLVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.85
4 0.84
5 0.83
6 0.78
7 0.73
8 0.71
9 0.72
10 0.73
11 0.76
12 0.78
13 0.79
14 0.86
15 0.87
16 0.86
17 0.88
18 0.88
19 0.89
20 0.88
21 0.88
22 0.88
23 0.88
24 0.87
25 0.81
26 0.8
27 0.78
28 0.78
29 0.77
30 0.74
31 0.74
32 0.7
33 0.7
34 0.71
35 0.68
36 0.63
37 0.58
38 0.5
39 0.46
40 0.48
41 0.48
42 0.45
43 0.45
44 0.48
45 0.47
46 0.55
47 0.57
48 0.55
49 0.53
50 0.48
51 0.43
52 0.38
53 0.36
54 0.3
55 0.27
56 0.25
57 0.22
58 0.2
59 0.19
60 0.16
61 0.13
62 0.12
63 0.11
64 0.12
65 0.13
66 0.13
67 0.14
68 0.14
69 0.14
70 0.13
71 0.12
72 0.1
73 0.09
74 0.11
75 0.11
76 0.13
77 0.18
78 0.2
79 0.22
80 0.25
81 0.31
82 0.33
83 0.38
84 0.37
85 0.36
86 0.38
87 0.36
88 0.33
89 0.3
90 0.25
91 0.21
92 0.2
93 0.16
94 0.13
95 0.13
96 0.15
97 0.13
98 0.19
99 0.19
100 0.2
101 0.2
102 0.22
103 0.23
104 0.19
105 0.2
106 0.16
107 0.18
108 0.2
109 0.21
110 0.18
111 0.17
112 0.17
113 0.15
114 0.15
115 0.12
116 0.1
117 0.09
118 0.1
119 0.1
120 0.1
121 0.09
122 0.08
123 0.08
124 0.08
125 0.11
126 0.1
127 0.09
128 0.1
129 0.11
130 0.11
131 0.12
132 0.13
133 0.09
134 0.1
135 0.1
136 0.1
137 0.1
138 0.09
139 0.09
140 0.08
141 0.1
142 0.1
143 0.1
144 0.1
145 0.08
146 0.07
147 0.08
148 0.08
149 0.06
150 0.07
151 0.07
152 0.08
153 0.09
154 0.11
155 0.12
156 0.11
157 0.11
158 0.12
159 0.14
160 0.15
161 0.22
162 0.23
163 0.22
164 0.26
165 0.26
166 0.25
167 0.25
168 0.22
169 0.2
170 0.18
171 0.21
172 0.2
173 0.22
174 0.22
175 0.22
176 0.22
177 0.18
178 0.21
179 0.22
180 0.23
181 0.2
182 0.19
183 0.18
184 0.18
185 0.18
186 0.15
187 0.1
188 0.08
189 0.13
190 0.17
191 0.24
192 0.25
193 0.25
194 0.25
195 0.28
196 0.28
197 0.24
198 0.24
199 0.18
200 0.2
201 0.22
202 0.2
203 0.17
204 0.17
205 0.17
206 0.13
207 0.14
208 0.15
209 0.12
210 0.12
211 0.13
212 0.13
213 0.12
214 0.12
215 0.11
216 0.07
217 0.07
218 0.09
219 0.1
220 0.12
221 0.12
222 0.12
223 0.12
224 0.11
225 0.11
226 0.1
227 0.16
228 0.16
229 0.17
230 0.18
231 0.18
232 0.18
233 0.17
234 0.2
235 0.2
236 0.24
237 0.31
238 0.4
239 0.47
240 0.49
241 0.53
242 0.53
243 0.51
244 0.49
245 0.48
246 0.45
247 0.42
248 0.4
249 0.37
250 0.34
251 0.34
252 0.33
253 0.3
254 0.26
255 0.3
256 0.31
257 0.36
258 0.39
259 0.4
260 0.47
261 0.52
262 0.58
263 0.56
264 0.56
265 0.53
266 0.51
267 0.44
268 0.36
269 0.31
270 0.24
271 0.25
272 0.25
273 0.21
274 0.24
275 0.3
276 0.37
277 0.36
278 0.37
279 0.36
280 0.37
281 0.39
282 0.36
283 0.34
284 0.28
285 0.28
286 0.26
287 0.3
288 0.28
289 0.28
290 0.27
291 0.23
292 0.22
293 0.2
294 0.2
295 0.13
296 0.14
297 0.12
298 0.12
299 0.12
300 0.13
301 0.11
302 0.1