Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CPR1

Protein Details
Accession A0A1B8CPR1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
197-216VVLIGKRKKRKATQEEAAETHydrophilic
NLS Segment(s)
PositionSequence
202-207KRKKRK
Subcellular Location(s) mito 22, cyto_mito 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MRNPRCAFSAAAALYRVFILPASRPLLSQFRPQLRPSTLTKSTTSTLLQNRGYASALPRDEQIAKQNFPYVHLVDETGKLSPPQRVADILATLDRKTQSLHTVALPPPRLRSRWEAPPEAAPASEEGPGRAVPEIPVCKIITKAAAAKPTKSVKKKAANPSATVKTLELNWAIDPHDLEHRLKRMKDFLEKGYRVDVVLIGKRKKRKATQEEAAETLRRVGGGVGEVEGAREWKAMEGNVGGVVTVYLEGKAKKVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.18
4 0.1
5 0.1
6 0.1
7 0.11
8 0.16
9 0.19
10 0.19
11 0.19
12 0.24
13 0.31
14 0.31
15 0.38
16 0.41
17 0.46
18 0.51
19 0.53
20 0.56
21 0.53
22 0.54
23 0.51
24 0.51
25 0.48
26 0.46
27 0.46
28 0.43
29 0.4
30 0.38
31 0.35
32 0.33
33 0.33
34 0.37
35 0.36
36 0.34
37 0.33
38 0.31
39 0.31
40 0.25
41 0.22
42 0.22
43 0.22
44 0.2
45 0.2
46 0.22
47 0.23
48 0.23
49 0.3
50 0.28
51 0.28
52 0.28
53 0.33
54 0.3
55 0.31
56 0.33
57 0.25
58 0.21
59 0.2
60 0.2
61 0.17
62 0.18
63 0.16
64 0.13
65 0.12
66 0.12
67 0.13
68 0.15
69 0.17
70 0.17
71 0.17
72 0.17
73 0.19
74 0.19
75 0.18
76 0.15
77 0.15
78 0.14
79 0.13
80 0.14
81 0.13
82 0.12
83 0.13
84 0.14
85 0.14
86 0.15
87 0.17
88 0.16
89 0.2
90 0.22
91 0.26
92 0.27
93 0.25
94 0.27
95 0.29
96 0.29
97 0.28
98 0.32
99 0.32
100 0.38
101 0.43
102 0.41
103 0.39
104 0.4
105 0.38
106 0.32
107 0.27
108 0.18
109 0.13
110 0.12
111 0.13
112 0.1
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.08
119 0.06
120 0.1
121 0.11
122 0.1
123 0.12
124 0.12
125 0.12
126 0.13
127 0.13
128 0.1
129 0.11
130 0.14
131 0.15
132 0.22
133 0.22
134 0.23
135 0.28
136 0.34
137 0.41
138 0.42
139 0.46
140 0.48
141 0.57
142 0.65
143 0.69
144 0.72
145 0.67
146 0.65
147 0.65
148 0.6
149 0.52
150 0.44
151 0.34
152 0.25
153 0.22
154 0.21
155 0.15
156 0.12
157 0.11
158 0.11
159 0.12
160 0.11
161 0.11
162 0.1
163 0.14
164 0.16
165 0.18
166 0.21
167 0.27
168 0.32
169 0.34
170 0.36
171 0.37
172 0.4
173 0.47
174 0.47
175 0.48
176 0.53
177 0.52
178 0.5
179 0.46
180 0.42
181 0.33
182 0.29
183 0.23
184 0.17
185 0.21
186 0.27
187 0.31
188 0.36
189 0.44
190 0.51
191 0.58
192 0.63
193 0.69
194 0.72
195 0.76
196 0.79
197 0.8
198 0.77
199 0.71
200 0.65
201 0.55
202 0.45
203 0.37
204 0.28
205 0.18
206 0.14
207 0.11
208 0.09
209 0.09
210 0.09
211 0.08
212 0.09
213 0.09
214 0.09
215 0.09
216 0.09
217 0.08
218 0.08
219 0.08
220 0.09
221 0.11
222 0.11
223 0.13
224 0.13
225 0.13
226 0.13
227 0.13
228 0.1
229 0.09
230 0.08
231 0.06
232 0.06
233 0.06
234 0.06
235 0.09
236 0.1
237 0.12