Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CR96

Protein Details
Accession A0A1B8CR96    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
300-319VVDPRFKKIQKMSRRTKSLAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 10.5, nucl 6, mito 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
IPR038718  SNF2-like_sf  
IPR000330  SNF2_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0140658  F:ATP-dependent chromatin remodeler activity  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00176  SNF2-rel_dom  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MTKVSSDKMPNFENSTQIATIIVGDEKKEWNISTDLLRVHSGYFRSALKGGFIEAQIRRVELLNEEPPTFELVVEWLFTHGIKERHPRPFVETKFDFLQPEFRKLFEAYILAEYLQMPALQNYLIKFMNDRVAKYEYVSESDFAWAFEQVGGQTPLGRWIVNCCAQVMAFERLVIGPLVDLEAAAAVEEGEEPTLSTEELRTISTKAAGLFGIVLADESHKLKSVFTRTHQSIARLGAQHMLLITTTPTINKSIDFPNPGQIEGADKASIDVTEVVLLILARHTSAFKIFRSINVGDSLVVDPRFKKIQKMSRRTKSLAKMTRKEFCYPKDYIANASTITTFDLVRKALSTLKALRGKELRAEDARLEELDEYLRKIKAAADMFNATVKASISNKELADHPALVNATVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.33
4 0.29
5 0.25
6 0.18
7 0.16
8 0.14
9 0.14
10 0.11
11 0.12
12 0.14
13 0.16
14 0.18
15 0.2
16 0.19
17 0.2
18 0.21
19 0.23
20 0.24
21 0.26
22 0.25
23 0.25
24 0.26
25 0.23
26 0.22
27 0.24
28 0.22
29 0.2
30 0.21
31 0.2
32 0.22
33 0.24
34 0.22
35 0.2
36 0.19
37 0.19
38 0.19
39 0.18
40 0.22
41 0.21
42 0.25
43 0.23
44 0.23
45 0.23
46 0.21
47 0.21
48 0.17
49 0.22
50 0.23
51 0.25
52 0.25
53 0.25
54 0.24
55 0.26
56 0.23
57 0.17
58 0.12
59 0.1
60 0.11
61 0.11
62 0.1
63 0.08
64 0.08
65 0.08
66 0.1
67 0.13
68 0.15
69 0.21
70 0.3
71 0.37
72 0.46
73 0.49
74 0.49
75 0.52
76 0.59
77 0.57
78 0.57
79 0.5
80 0.45
81 0.46
82 0.46
83 0.4
84 0.31
85 0.37
86 0.31
87 0.37
88 0.33
89 0.3
90 0.31
91 0.3
92 0.3
93 0.22
94 0.2
95 0.15
96 0.15
97 0.15
98 0.12
99 0.12
100 0.11
101 0.1
102 0.09
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.11
111 0.11
112 0.11
113 0.12
114 0.13
115 0.21
116 0.21
117 0.21
118 0.22
119 0.24
120 0.24
121 0.24
122 0.27
123 0.2
124 0.21
125 0.21
126 0.18
127 0.15
128 0.17
129 0.16
130 0.12
131 0.11
132 0.09
133 0.08
134 0.08
135 0.08
136 0.06
137 0.09
138 0.09
139 0.08
140 0.09
141 0.09
142 0.12
143 0.12
144 0.12
145 0.09
146 0.12
147 0.17
148 0.2
149 0.2
150 0.17
151 0.17
152 0.16
153 0.17
154 0.18
155 0.16
156 0.12
157 0.11
158 0.11
159 0.11
160 0.12
161 0.1
162 0.06
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.06
187 0.07
188 0.07
189 0.08
190 0.08
191 0.09
192 0.1
193 0.09
194 0.09
195 0.08
196 0.07
197 0.06
198 0.06
199 0.05
200 0.04
201 0.04
202 0.03
203 0.04
204 0.05
205 0.06
206 0.06
207 0.08
208 0.08
209 0.09
210 0.13
211 0.19
212 0.22
213 0.25
214 0.32
215 0.32
216 0.37
217 0.38
218 0.36
219 0.32
220 0.3
221 0.31
222 0.24
223 0.23
224 0.2
225 0.18
226 0.17
227 0.13
228 0.11
229 0.07
230 0.06
231 0.06
232 0.05
233 0.05
234 0.06
235 0.07
236 0.08
237 0.09
238 0.09
239 0.12
240 0.15
241 0.18
242 0.21
243 0.21
244 0.26
245 0.26
246 0.26
247 0.23
248 0.2
249 0.2
250 0.17
251 0.17
252 0.1
253 0.09
254 0.1
255 0.1
256 0.09
257 0.07
258 0.06
259 0.05
260 0.05
261 0.06
262 0.05
263 0.05
264 0.05
265 0.04
266 0.04
267 0.04
268 0.04
269 0.05
270 0.05
271 0.06
272 0.11
273 0.14
274 0.14
275 0.19
276 0.19
277 0.21
278 0.26
279 0.26
280 0.24
281 0.23
282 0.23
283 0.17
284 0.19
285 0.18
286 0.15
287 0.15
288 0.14
289 0.13
290 0.16
291 0.23
292 0.22
293 0.29
294 0.35
295 0.45
296 0.54
297 0.65
298 0.72
299 0.75
300 0.82
301 0.78
302 0.78
303 0.77
304 0.76
305 0.75
306 0.75
307 0.73
308 0.72
309 0.76
310 0.71
311 0.69
312 0.65
313 0.61
314 0.56
315 0.5
316 0.49
317 0.48
318 0.45
319 0.42
320 0.37
321 0.34
322 0.28
323 0.27
324 0.22
325 0.15
326 0.15
327 0.12
328 0.11
329 0.11
330 0.13
331 0.13
332 0.13
333 0.14
334 0.14
335 0.18
336 0.2
337 0.24
338 0.26
339 0.35
340 0.4
341 0.4
342 0.46
343 0.46
344 0.46
345 0.47
346 0.47
347 0.44
348 0.41
349 0.44
350 0.38
351 0.37
352 0.36
353 0.29
354 0.26
355 0.19
356 0.17
357 0.18
358 0.17
359 0.17
360 0.2
361 0.2
362 0.19
363 0.19
364 0.21
365 0.25
366 0.28
367 0.27
368 0.29
369 0.3
370 0.31
371 0.33
372 0.3
373 0.22
374 0.2
375 0.17
376 0.17
377 0.17
378 0.2
379 0.21
380 0.26
381 0.26
382 0.27
383 0.29
384 0.28
385 0.3
386 0.29
387 0.26
388 0.25
389 0.25
390 0.24