Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7Z3F6

Protein Details
Accession C7Z3F6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MARKTSKAAKRAQNKAKPRTRARPKPKPKSTTSASHydrophilic
NLS Segment(s)
PositionSequence
3-29RKTSKAAKRAQNKAKPRTRARPKPKPK
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
KEGG nhe:NECHADRAFT_83232  -  
Amino Acid Sequences MARKTSKAAKRAQNKAKPRTRARPKPKPKSTTSASPSERIDTDVLLAIKPDHLANIISREKNHEYRKYRLKDGVVRLWLYETAGGGGRASITHIARIPSSIRHEPGSVPTEPPGIGNAEFNAGLKQSKFGYPILELYELVNPVTLSEMKTRWAMGGAPMGWRYLEAPLWRDRWGKDHTRDDKVKKVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.87
5 0.87
6 0.88
7 0.88
8 0.9
9 0.9
10 0.91
11 0.93
12 0.94
13 0.94
14 0.91
15 0.87
16 0.84
17 0.79
18 0.78
19 0.72
20 0.7
21 0.63
22 0.59
23 0.54
24 0.48
25 0.42
26 0.34
27 0.3
28 0.2
29 0.18
30 0.17
31 0.16
32 0.13
33 0.13
34 0.1
35 0.1
36 0.11
37 0.1
38 0.06
39 0.07
40 0.08
41 0.09
42 0.15
43 0.2
44 0.2
45 0.21
46 0.27
47 0.31
48 0.39
49 0.45
50 0.48
51 0.48
52 0.56
53 0.65
54 0.64
55 0.63
56 0.6
57 0.58
58 0.56
59 0.57
60 0.55
61 0.48
62 0.43
63 0.38
64 0.34
65 0.28
66 0.21
67 0.15
68 0.09
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.05
77 0.07
78 0.07
79 0.08
80 0.09
81 0.1
82 0.1
83 0.11
84 0.11
85 0.12
86 0.17
87 0.18
88 0.19
89 0.19
90 0.2
91 0.2
92 0.23
93 0.24
94 0.19
95 0.17
96 0.17
97 0.16
98 0.16
99 0.15
100 0.12
101 0.1
102 0.09
103 0.09
104 0.08
105 0.09
106 0.09
107 0.09
108 0.08
109 0.07
110 0.08
111 0.08
112 0.09
113 0.1
114 0.11
115 0.13
116 0.13
117 0.15
118 0.15
119 0.17
120 0.18
121 0.17
122 0.16
123 0.15
124 0.16
125 0.14
126 0.13
127 0.12
128 0.09
129 0.08
130 0.1
131 0.1
132 0.1
133 0.13
134 0.14
135 0.15
136 0.16
137 0.17
138 0.15
139 0.15
140 0.14
141 0.13
142 0.17
143 0.16
144 0.18
145 0.18
146 0.18
147 0.17
148 0.16
149 0.15
150 0.12
151 0.16
152 0.15
153 0.19
154 0.24
155 0.27
156 0.31
157 0.34
158 0.33
159 0.36
160 0.41
161 0.47
162 0.5
163 0.59
164 0.62
165 0.68
166 0.76
167 0.76