Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8BX90

Protein Details
Accession A0A1B8BX90    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-33NAPTRTSTRTPKPSARKRAQSTPIPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
Amino Acid Sequences MAPLQSPNAPTRTSTRTPKPSARKRAQSTPIPTGSVVILSDADQDILDTAEDAEEADAKEAEEEEAEEEEAEEEEAEEEEAEEAEEEEAEEAEEETLKFMSIWRASCGKEQLLGTRSRVLDPSLISLMAVHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.57
4 0.63
5 0.71
6 0.76
7 0.79
8 0.83
9 0.84
10 0.85
11 0.82
12 0.85
13 0.83
14 0.81
15 0.77
16 0.74
17 0.66
18 0.57
19 0.5
20 0.41
21 0.33
22 0.24
23 0.17
24 0.1
25 0.08
26 0.07
27 0.08
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.04
40 0.03
41 0.04
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.05
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.12
88 0.14
89 0.16
90 0.19
91 0.22
92 0.24
93 0.28
94 0.31
95 0.27
96 0.28
97 0.27
98 0.31
99 0.32
100 0.33
101 0.31
102 0.34
103 0.34
104 0.32
105 0.32
106 0.27
107 0.26
108 0.24
109 0.26
110 0.21
111 0.2
112 0.18