Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C5J1

Protein Details
Accession A0A1B8C5J1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AKSKNSSQHNQSKKAHRNGIKKPKTSHydrophilic
NLS Segment(s)
PositionSequence
14-46KKAHRNGIKKPKTSRYPSLKGTDPKFRRNHKHA
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHKHALHGTMKALKAAREESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.81
7 0.85
8 0.82
9 0.8
10 0.78
11 0.78
12 0.78
13 0.76
14 0.74
15 0.72
16 0.69
17 0.67
18 0.63
19 0.6
20 0.57
21 0.54
22 0.55
23 0.51
24 0.54
25 0.57
26 0.62
27 0.66
28 0.66
29 0.73
30 0.68
31 0.74
32 0.7
33 0.7
34 0.67
35 0.6
36 0.58
37 0.53
38 0.48
39 0.41
40 0.37
41 0.31
42 0.29