Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C5P6

Protein Details
Accession A0A1B8C5P6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTTKIKKGSQRQSRRKETLLKKAHydrophilic
NLS Segment(s)
PositionSequence
11-16RQSRRK
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MTTKIKKGSQRQSRRKETLLKKAHKMGILCDVDVALYLQIRKSGRRITYKPINRQCYNTSMEGSNSERQSRKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.83
4 0.8
5 0.8
6 0.79
7 0.76
8 0.71
9 0.71
10 0.68
11 0.61
12 0.53
13 0.44
14 0.43
15 0.37
16 0.3
17 0.23
18 0.2
19 0.16
20 0.15
21 0.13
22 0.04
23 0.04
24 0.04
25 0.04
26 0.08
27 0.09
28 0.1
29 0.14
30 0.21
31 0.27
32 0.35
33 0.38
34 0.44
35 0.53
36 0.61
37 0.68
38 0.71
39 0.74
40 0.68
41 0.7
42 0.64
43 0.59
44 0.54
45 0.46
46 0.39
47 0.32
48 0.31
49 0.3
50 0.31
51 0.33
52 0.32
53 0.36