Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CP59

Protein Details
Accession A0A1B8CP59   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-29SSTSCKSSNKSNVKTHRHKGAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.833, mito 9.5, cyto 9, cyto_nucl 5.333, extr 4, pero 4
Family & Domain DBs
Amino Acid Sequences MSESSPAASSTSCKSSNKSNVKTHRHKGAGSGFAVPLLDMFKVPLGTSLAHAYSVITGGSCLDPRANVESLGTGAFPKCEWTVSLNFDLNLDYSVDDPCFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.36
3 0.46
4 0.54
5 0.57
6 0.61
7 0.68
8 0.76
9 0.83
10 0.8
11 0.79
12 0.73
13 0.65
14 0.62
15 0.58
16 0.52
17 0.44
18 0.39
19 0.29
20 0.25
21 0.25
22 0.18
23 0.11
24 0.08
25 0.06
26 0.04
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.09
36 0.08
37 0.08
38 0.08
39 0.07
40 0.06
41 0.06
42 0.05
43 0.03
44 0.03
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.08
52 0.12
53 0.12
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.07
61 0.07
62 0.07
63 0.07
64 0.09
65 0.09
66 0.1
67 0.11
68 0.14
69 0.18
70 0.23
71 0.27
72 0.26
73 0.25
74 0.25
75 0.24
76 0.21
77 0.17
78 0.13
79 0.09
80 0.09
81 0.11